DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Tyro3

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_058788.1 Gene:Tyro3 / 25232 RGDID:3923 Length:880 Species:Rattus norvegicus


Alignment Length:253 Identity:55/253 - (21%)
Similarity:89/253 - (35%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDW--KLLIQFANERDE 154
            |.|:|.|..:....:.||:    |..::       ...|:.|:...|.| |  .|.::.|...|.
  Rat    50 VKLNCSVEGMDDPDIHWMK----DGAVV-------QNASQVSISISEQN-WIGLLSLKSAERSDA 102

  Fly   155 GPYECQV--SSHPPLVLLVYLTII-VPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSY 216
            |.|.|||  .....:...|:||:. ||...: :.:..|.|...     ..:|.|.....|.|.:.
  Rat   103 GLYWCQVKDGEETKISQSVWLTV
EGVPFFTV-EPKDLAVPPNV-----PFQLSCEAVGPPEPVTI 161

  Fly   217 ITWR---------HGPRLLNYD--TSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNE 270
            ..||         ..|.:||..  |.|...|.:...:.|.|.||..|..........:...:...
  Rat   162 FWWRGPTKVGGPASSPSVLNVTGVTQRTEFSCEAHNIKGLATSRPAIIRLQAPPAAPFNITVTTI 226

  Fly   271 ITETVVVHVLNGEEPAAM--------QHANGSRQKANASTMVVLFLVYVCISGSISVA 320
            .:....|..:.|.:..|:        .||.|..:   |..:||....:.|:..:::.|
  Rat   227 SSSNASVAWVPGADGLALLHSCTVQVAHAPGEWE---ALAVVVPVPPFTCLLRNLAPA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 20/74 (27%)
Ig 84..169 CDD:299845 20/80 (25%)
IG_like 191..279 CDD:214653 19/98 (19%)
Ig 201..274 CDD:143165 17/83 (20%)
Tyro3NP_058788.1 IG_like 39..125 CDD:214653 22/86 (26%)
IGc2 46..111 CDD:197706 20/72 (28%)
Ig2_Tyro3_like 131..209 CDD:143226 18/83 (22%)
IG_like 135..204 CDD:214653 16/73 (22%)
FN3 215..307 CDD:238020 11/70 (16%)
fn3 315..396 CDD:278470
PTKc_Tyro3 498..781 CDD:270659
Pkinase_Tyr 508..776 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 804..827
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 842..864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.