Sequence 1: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766486.1 | Gene: | Kirrel2 / 243911 | MGIID: | 2442334 | Length: | 700 | Species: | Mus musculus |
Alignment Length: | 384 | Identity: | 80/384 - (20%) |
---|---|---|---|
Similarity: | 123/384 - (32%) | Gaps: | 144/384 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 IGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLN 83
Fly 84 ISTQLSSSV----------YLHCRVNDLQGKTVS------------WMRRRGDDLTLITFGQHTY 126
Fly 127 SGDSRY----------SLEFEEPNDWKLLIQFANERDEGPYECQVS-----------------SH 164
Fly 165 PPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYI-TWRHG------ 222
Fly 223 -----------PRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQD-TGNYTCMLGNEITE-T 274
Fly 275 VVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVC-ISGSIS-------VAGMNRG 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 22/128 (17%) |
Ig | 84..169 | CDD:299845 | 24/133 (18%) | ||
IG_like | 191..279 | CDD:214653 | 23/107 (21%) | ||
Ig | 201..274 | CDD:143165 | 22/92 (24%) | ||
Kirrel2 | NP_766486.1 | IG | 27..116 | CDD:214652 | |
Ig | 122..220 | CDD:416386 | |||
Ig strand A | 123..126 | CDD:409353 | |||
Ig strand A' | 129..133 | CDD:409353 | |||
Ig strand B | 140..147 | CDD:409353 | |||
Cell attachment site. /evidence=ECO:0000255 | 146..148 | ||||
Ig strand C | 153..158 | CDD:409353 | |||
Ig strand C' | 161..163 | CDD:409353 | |||
Ig strand D | 166..173 | CDD:409353 | |||
Ig strand E | 180..188 | CDD:409353 | |||
Ig strand F | 197..205 | CDD:409353 | |||
Ig strand G | 211..217 | CDD:409353 | |||
Ig_3 | 223..292 | CDD:404760 | 15/70 (21%) | ||
Ig strand B | 241..245 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 255..259 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 272..275 | CDD:409353 | 1/2 (50%) | ||
Ig strand F | 281..290 | CDD:409353 | 3/13 (23%) | ||
Ig strand G | 298..301 | CDD:409353 | 0/2 (0%) | ||
Ig | 315..392 | CDD:416386 | 18/97 (19%) | ||
Ig strand A' | 316..321 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 324..333 | CDD:409353 | 1/11 (9%) | ||
Ig strand C | 339..343 | CDD:409353 | 2/6 (33%) | ||
Ig strand C' | 346..348 | CDD:409353 | 1/1 (100%) | ||
Ig strand D | 351..354 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 355..360 | CDD:409353 | 0/4 (0%) | ||
Ig strand F | 368..376 | CDD:409353 | 3/7 (43%) | ||
Ig strand G | 382..392 | CDD:409353 | 0/9 (0%) | ||
Ig | 394..498 | CDD:416386 | 33/135 (24%) | ||
Ig strand A | 395..399 | CDD:409353 | 3/8 (38%) | ||
Ig strand A' | 401..404 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 412..419 | CDD:409353 | 5/18 (28%) | ||
Ig strand C | 426..431 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 433..436 | CDD:409353 | 1/2 (50%) | ||
Ig strand D | 444..451 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 461..468 | CDD:409353 | 3/7 (43%) | ||
Ig strand F | 479..486 | CDD:409353 | 1/6 (17%) | ||
Ig strand G | 489..496 | CDD:409353 | 2/6 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 542..576 | 2/10 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 671..700 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |