DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Lrit1

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_666357.2 Gene:Lrit1 / 239037 MGIID:2385320 Length:624 Species:Mus musculus


Alignment Length:162 Identity:36/162 - (22%)
Similarity:53/162 - (32%) Gaps:36/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WILAIIYSSLHHIGSGSTSTTL----KRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETT 67
            |:.......|.|:..|..|:.|    .|.|...|.......|              .:||:.:..
Mouse   203 WVCDCRLYDLVHLLDGWVSSNLIFIEARLRCASPRSLAGVAF--------------SQLELRKCQ 253

  Fly    68 THEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRY 132
            :.|..|      ...:|.:.|.|:|.|.|....:.|..:||.|..|..|......:.:..|.|  
Mouse   254 SPELRP------GVTSIISPLGSTVLLRCGATGIPGPEMSWRRANGRPLNGTVHQEVSSDGSS-- 310

  Fly   133 SLEFEEPNDWKLL-IQFANERDEGPYECQVSS 163
                     |.|| :...:..|.|.|.||..:
Mouse   311 ---------WTLLDLPVVSLFDSGDYICQAKN 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 22/80 (28%)
Ig 84..169 CDD:299845 22/81 (27%)
IG_like 191..279 CDD:214653
Ig 201..274 CDD:143165
Lrit1NP_666357.2 LRRNT 23..61 CDD:214470
LRR 1 60..81
LRR_8 63..143 CDD:290566
leucine-rich repeat 64..84 CDD:275378
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..129
LRR_8 131..>176 CDD:290566
LRR_4 131..172 CDD:289563
LRR 4 132..153
leucine-rich repeat 133..156 CDD:275378
LRR 5 156..177
leucine-rich repeat 157..180 CDD:275378
leucine-rich repeat 181..205 CDD:275378 1/1 (100%)
TPKR_C2 201..>241 CDD:301599 9/37 (24%)
Ig 258..346 CDD:299845 23/93 (25%)
IG_like 268..346 CDD:214653 21/77 (27%)
FN3 432..502 CDD:214495
LRR 6 526..549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.