Sequence 1: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011240777.1 | Gene: | Igsf9b / 235086 | MGIID: | 2685354 | Length: | 1443 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 49/200 - (24%) |
---|---|---|---|
Similarity: | 78/200 - (39%) | Gaps: | 42/200 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 ISTQLSSSVYLHCRV-NDLQGK----TVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWK 143
Fly 144 LLIQFANERDEGPYECQVSSHPPLVL-----------LVYLTIIVPHVEILDERGSATPEKYYKA 197
Fly 198 --GSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDT 260
Fly 261 GNYTC 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 19/83 (23%) |
Ig | 84..169 | CDD:299845 | 20/89 (22%) | ||
IG_like | 191..279 | CDD:214653 | 21/76 (28%) | ||
Ig | 201..274 | CDD:143165 | 17/64 (27%) | ||
Igsf9b | XP_011240777.1 | Ig | 43..117 | CDD:319273 | 18/73 (25%) |
I-set | 141..227 | CDD:369462 | 22/82 (27%) | ||
Ig | 231..323 | CDD:386229 | |||
Ig | <355..416 | CDD:386229 | |||
Ig | 440..504 | CDD:319273 | |||
FN3 | 512..607 | CDD:238020 | |||
FN3 | 623..705 | CDD:238020 | |||
PHA03247 | <900..1248 | CDD:223021 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |