DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:200 Identity:49/200 - (24%)
Similarity:78/200 - (39%) Gaps:42/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ISTQLSSSVYLHCRV-NDLQGK----TVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWK 143
            ::.:....|.|.|.| :.:.|:    .|.|.:........|.||.:....|..|:......:...
Mouse    35 VTARAGEGVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKAS 99

  Fly   144 LLIQFANERDEGPYECQVSSHPPLVL-----------LVYLTIIVPHVEILDERGSATPEKYYKA 197
            |.::.....|:|.|||:|     |:|           .|:|||..|      ...:.||.:|.:|
Mouse   100 LRLEQVRSEDQGWYECKV-----LMLDQQYDTFHNGSWVHLTINAP------PTFTETPPQYIEA 153

  Fly   198 --GSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDT 260
              |.:|.:.|  :...:|...:||.....||       |.|.|..:..|    .|.:.:.:|:|.
Mouse   154 KEGGSITMTC--TAFGNPKPIVTWLKEGTLL-------GASAKYQVSDG----SLTVTSVSREDR 205

  Fly   261 GNYTC 265
            |.|||
Mouse   206 GAYTC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 19/83 (23%)
Ig 84..169 CDD:299845 20/89 (22%)
IG_like 191..279 CDD:214653 21/76 (28%)
Ig 201..274 CDD:143165 17/64 (27%)
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273 18/73 (25%)
I-set 141..227 CDD:369462 22/82 (27%)
Ig 231..323 CDD:386229
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.