DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and IGSF9B

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:204 Identity:49/204 - (24%)
Similarity:78/204 - (38%) Gaps:50/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ISTQLSSSVYLHCRV-NDLQGK----TVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWK 143
            ::.:...||.|.|.| :.:.|:    .|.|.:........|.||.:....|..|:......:...
Human    33 VTARAGESVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKAS 97

  Fly   144 LLIQFANERDEGPYECQVSSHPPLVL-----------LVYLTIIVPHVEILDERGSATPEKYYKA 197
            |.::.....|:|.|||:|     |:|           .|:|||..|      ...:.||.:|.:|
Human    98 LRLEQVRSEDQGWYECKV
-----LMLDQQYDTFHNGSWVHLTINAP------PTFTETPPQYIEA 151

  Fly   198 --GSTIELQCVISKIPHPSSYITWRHGPRLL----NYDTSRGGISVKTDMLPGRALSRLYIANAN 256
              |.:|.:.|  :...:|...:||.....||    .|..|.|.::|               .:.:
Human   152 KEGGSITMTC--TAFGNPKPIVTWLKEGTLLGASGKYQVSDGSLTV---------------TSVS 199

  Fly   257 RQDTGNYTC 265
            |:|.|.|||
Human   200 REDRGAYTC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 20/83 (24%)
Ig 84..169 CDD:299845 21/89 (24%)
IG_like 191..279 CDD:214653 21/81 (26%)
Ig 201..274 CDD:143165 17/69 (25%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 19/81 (23%)
Ig 41..115 CDD:143165 18/73 (25%)
I-set 139..225 CDD:254352 22/87 (25%)
IGc2 153..210 CDD:197706 18/73 (25%)
I-set 229..321 CDD:254352
Ig 235..321 CDD:299845
IG_like 331..414 CDD:214653
Ig <353..414 CDD:299845
IG_like 426..505 CDD:214653
Ig 442..505 CDD:299845
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.