DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Iglon5

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:270 Identity:64/270 - (23%)
Similarity:92/270 - (34%) Gaps:77/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRLFWILAIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETT 67
            :||..:.|...:.|..|..|..|.:|                  |||||                
Mouse     8 ARLRLLAAAALAGLAVISRGLLSQSL------------------EFSSP---------------- 38

  Fly    68 THEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRY 132
                    ||.||...     ..:..|.|.: |.....|:|:.|.    .::..|...::.|.|.
Mouse    39 --------ADNYTVCE-----GDNATLSCFI-DEHVTRVAWLNRS----NILYAGNDRWTSDPRV 85

  Fly   133 SLEFEEPNDWKLLIQFANERDEGPYECQVSS-HPPLVLLVYLTIIVPHVEILDERGSATPEKYYK 196
            .|....|.::.:||......|||.|.|...: |.|....|||.:.||...:......|..|    
Mouse    86 RLLINTPEEFSILITQVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISSPVAVNE---- 146

  Fly   197 AGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTG 261
             |..:.|.|:....|.|:  :|||   :|.:..||.|.|              |.|::..|...|
Mouse   147 -GGNVNLLCLAVGRPEPT--VTWR---QLRDGFTSEGEI--------------LEISDIQRGQAG 191

  Fly   262 NYTCMLGNEI 271
            .|.|:..|.:
Mouse   192 EYECVTHNGV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 18/79 (23%)
Ig 84..169 CDD:299845 20/85 (24%)
IG_like 191..279 CDD:214653 21/81 (26%)
Ig 201..274 CDD:143165 19/71 (27%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 25/97 (26%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 1/4 (25%)
FR2 61..68 CDD:409353 2/6 (33%)
Ig strand C 61..67 CDD:409353 2/5 (40%)
CDR2 69..79 CDD:409353 1/13 (8%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 11/34 (32%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 4/7 (57%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 4/8 (50%)
FR4 122..129 CDD:409353 3/6 (50%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 21/88 (24%)
Ig strand A' 140..145 CDD:409353 1/4 (25%)
Ig strand B 148..157 CDD:409353 2/8 (25%)
Ig strand C 163..167 CDD:409353 1/5 (20%)
Ig strand D 174..177 CDD:409353 2/2 (100%)
Ig strand E 178..183 CDD:409353 2/18 (11%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760
putative Ig strand A 218..224 CDD:409353
Ig strand B 234..238 CDD:409353
Ig strand C 247..251 CDD:409353
Ig strand E 274..278 CDD:409353
Ig strand F 288..293 CDD:409353
Ig strand G 301..304 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.