| Sequence 1: | NP_001245573.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_660339.1 | Gene: | CADM4 / 199731 | HGNCID: | 30825 | Length: | 388 | Species: | Homo sapiens |
| Alignment Length: | 349 | Identity: | 67/349 - (19%) |
|---|---|---|---|
| Similarity: | 106/349 - (30%) | Gaps: | 128/349 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 81 TLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLL 145
Fly 146 IQFANERDEGPYECQVSSHPPLVLLVYLTIIV----PHVEILDE----------------RGSAT 190
Fly 191 PEKY------------------------------------------------------------- 194
Fly 195 --------------YKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGR 245
Fly 246 ALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVL--FL 308
Fly 309 VYVCISGSISVAGMNRGLGLGQVW 332 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr14 | NP_001245573.1 | IG_like | 83..163 | CDD:214653 | 20/79 (25%) |
| Ig | 84..169 | CDD:299845 | 19/84 (23%) | ||
| IG_like | 191..279 | CDD:214653 | 23/162 (14%) | ||
| Ig | 201..274 | CDD:143165 | 20/72 (28%) | ||
| CADM4 | NP_660339.1 | Ig | 29..120 | CDD:416386 | 22/93 (24%) |
| FR1 | 29..45 | CDD:409353 | 2/15 (13%) | ||
| Ig strand A' | 30..36 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 38..46 | CDD:409353 | 1/7 (14%) | ||
| CDR1 | 46..51 | CDD:409353 | 0/4 (0%) | ||
| FR2 | 52..59 | CDD:409353 | 1/8 (13%) | ||
| Ig strand C | 52..58 | CDD:409353 | 1/7 (14%) | ||
| CDR2 | 60..71 | CDD:409353 | 3/10 (30%) | ||
| Ig strand C' | 62..66 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C' | 68..71 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 72..107 | CDD:409353 | 12/35 (34%) | ||
| Ig strand D | 76..83 | CDD:409353 | 3/6 (50%) | ||
| Ig strand E | 86..92 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 99..107 | CDD:409353 | 5/7 (71%) | ||
| CDR3 | 108..111 | CDD:409353 | 0/2 (0%) | ||
| Ig strand G | 111..120 | CDD:409353 | 1/8 (13%) | ||
| FR4 | 113..120 | CDD:409353 | 1/6 (17%) | ||
| IgI_2_Necl-4 | 121..220 | CDD:409468 | 8/98 (8%) | ||
| Ig strand B | 141..145 | CDD:409468 | 0/3 (0%) | ||
| Ig strand C | 155..159 | CDD:409468 | 1/3 (33%) | ||
| Ig strand E | 182..186 | CDD:409468 | 0/3 (0%) | ||
| Ig strand F | 196..201 | CDD:409468 | 0/4 (0%) | ||
| Ig strand G | 213..216 | CDD:409468 | 0/2 (0%) | ||
| Ig_3 | 224..295 | CDD:404760 | 21/84 (25%) | ||
| Ig strand A' | 231..235 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 241..248 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 255..260 | CDD:409353 | 2/5 (40%) | ||
| Ig strand C' | 262..264 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 274..280 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 287..294 | CDD:409353 | 4/6 (67%) | ||
| Ig strand G | 300..308 | CDD:409353 | 2/7 (29%) | ||
| 4.1m | 344..362 | CDD:128590 | 2/3 (67%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I5236 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.960 | |||||