DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and zig-3

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:285 Identity:62/285 - (21%)
Similarity:96/285 - (33%) Gaps:73/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEF-SSPFTDTPEDEELEVTETTTHEP 71
            :||.|  |.|.:.||.....:             .|..:|. |:..|..|..:.:|..|..|   
 Worm     8 VLAAI--SAHPLSSGEMRAAV-------------SNLVREIDSTHLTTKPSLKIIEGLEDNT--- 54

  Fly    72 FPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSW----MRRRGD------DLTLITFGQHTY 126
                        :||  ..||.|.|.|.......:.|    .|.:||      :..|...|....
 Worm    55 ------------VST--GESVTLRCDVLSTPTGVIYWEKDGQRIQGDKELNVFEKVLNAMGPTVE 105

  Fly   127 SG--DSRYSLEFEEPNDWKLLIQFANERDEGPYEC-QVSSHPPLVLLVYLTIIVPHVEILDERGS 188
            ||  .|.|.            |..||....|.|:| ..:.|..:.....:::....|:....|.|
 Worm   106 SGIITSSYQ------------IPCANLHHIGSYKCVATNGHDTVESSAKISVEGQTVKCKSTRRS 158

  Fly   189 ATPEKYYKAGSTIELQ----CVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSR 249
            | |.......|..|||    .:|.:....::: .|....:.:::|:.|      .::||.   ..
 Worm   159 A-PVITMSTESRFELQDNAATLICRADRRANW-NWMFEDKKIDFDSGR------YELLPS---GD 212

  Fly   250 LYIANANRQDTGNYTCMLGNEITET 274
            |.|......|.|:|.|:..|:..|:
 Worm   213 LLIRKIQWSDMGSYFCIAHNKYGES 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 23/92 (25%)
Ig 84..169 CDD:299845 24/97 (25%)
IG_like 191..279 CDD:214653 19/88 (22%)
Ig 201..274 CDD:143165 16/76 (21%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 27/128 (21%)
Ig 61..142 CDD:143165 21/92 (23%)
IG_like 177..244 CDD:214653 14/71 (20%)
Ig <191..237 CDD:299845 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.