DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and zig-2

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:247 Identity:55/247 - (22%)
Similarity:83/247 - (33%) Gaps:67/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FTDTPEDEELEVTET------TTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMR 110
            ||.||.|..:...|.      ....|.|........:.|..:.:|:||.:. :||  ||.||   
 Worm    35 FTRTPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENI-LND--GKQVS--- 93

  Fly   111 RRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTI 175
                :..:::         |.|.            |..|..|:.|.|:|.:.:.        ||.
 Worm    94 ----NAAMVS---------SHYR------------IPCATARNSGAYKCIIDNG--------LTK 125

  Fly   176 IVPHVEILDERGSATPEKYYKAGS-----TIELQCVISK-------IPHPSSYITWRHGPRLLNY 228
            : .||..:...|:.|.......|:     |::.:..||.       ....::..:|..|.:||..
 Worm   126 L-EHVAKVFVGGNKTNCALNDNGAPFISMTVDFRLEISNNAVALSCRSETATEWSWHKGEQLLTN 189

  Fly   229 DTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEITETVVVHVL 280
            |..|      ..|.|.   ..|.|.|.:..|.|.|.|...|...||..:..|
 Worm   190 DGER------YQMFPS---GDLIIRNISWSDMGEYNCTARNHFGETTAITFL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 18/79 (23%)
Ig 84..169 CDD:299845 18/84 (21%)
IG_like 191..279 CDD:214653 22/99 (22%)
Ig 201..274 CDD:143165 18/79 (23%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 30/138 (22%)
Ig 34..121 CDD:299845 26/116 (22%)
Ig <179..232 CDD:299845 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.