DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and DSCAM

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens


Alignment Length:212 Identity:51/212 - (24%)
Similarity:84/212 - (39%) Gaps:47/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQ 147
            ||:.......|:||||......::.|.:    :..|:.|.....:.::..:|:..:       :|
Human   512 NITAIAGRDTYIHCRVIGYPYYSIKWYK----NSNLLPFNHRQVAFENNGTLKLSD-------VQ 565

  Fly   148 FANERDEGPYECQVSSHPPLVL--LVYLTIIVPHVEILDERGSATPEKY--YKAGSTIELQCVIS 208
              .|.|||.|.|.|...|.|..  .|::|:.||..        ..|.::  :..|..:.:.||:.
Human   566 --KEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPF--------IQPFEFPRFSIGQRVFIPCVVV 620

  Fly   209 KIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEITE 273
            ....|.: |||:...|.:     .|.:.|..|.:.  ..|.|.|:|.:....|||||:..|    
Human   621 SGDLPIT-ITWQKDGRPI-----PGSLGVTIDNID--FTSSLRISNLSLMHNGNYTCIARN---- 673

  Fly   274 TVVVHVLNGEEPAAMQH 290
                      |.||::|
Human   674 ----------EAAAVEH 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 19/79 (24%)
Ig 84..169 CDD:299845 20/84 (24%)
IG_like 191..279 CDD:214653 22/89 (25%)
Ig 201..274 CDD:143165 20/72 (28%)
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706 15/69 (22%)
I-set 596..686 CDD:333254 27/115 (23%)
Ig_DSCAM 707..784 CDD:143211
Ig 802..889 CDD:325142
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.