DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and rig-3

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:85 Identity:20/85 - (23%)
Similarity:34/85 - (40%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCML 267
            :.|.::....|..:.|:.||...:.. :.:..|.|...:..|   :.|.|.|.|..|.|.|.|..
 Worm   269 IYCNVTHSFPPVRHYTFYHGDEEIKM-SDKFNIFVNVGVSQG---AHLKIHNVNENDLGTYKCEA 329

  Fly   268 GNEITETV-VVHVLNGEEPA 286
            .|...::. .:|:.....||
 Worm   330 NNIKAKSYHTIHLREANAPA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653
Ig 84..169 CDD:299845
IG_like 191..279 CDD:214653 17/76 (22%)
Ig 201..274 CDD:143165 17/70 (24%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653
Ig 267..341 CDD:319273 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.