DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and igcm-2

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001362087.1 Gene:igcm-2 / 180913 WormBaseID:WBGene00020130 Length:802 Species:Caenorhabditis elegans


Alignment Length:287 Identity:67/287 - (23%)
Similarity:100/287 - (34%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IIYSSLHHIGSGSTSTTLKRPRAGDP--FDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFP 73
            |.:|....|.|.|...||.....||.  :.....|.....:|..       ::..|:.|..:..|
 Worm   157 ITWSRNEQIISTSPVLTLSNLEEGDKGLYTCLAVNIEGNSTSSI-------DVRFTKATILDLIP 214

  Fly    74 FFADPYTTLNISTQLSSSVYLHCRVNDLQGKTV--SWM-RRRGDDLTLITFGQHTYSGDSRYSLE 135
                    ||.:....|:|:.||..| .|...:  ||: .::....|.:....:..|||      
 Worm   215 --------LNKTVIEGSNVFWHCHAN-AQATAISYSWLFEKKPIKTTSLGLRSNIRSGD------ 264

  Fly   136 FEEPNDWKLLIQFANERDEGPYECQV--SSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAG 198
                    |.:|...:.|.|.|.|:.  |:........||.:..|.    :...|..|.:...:|
 Worm   265 --------LSLQDVRKSDSGWYTCEAKNSAGETTSSTAYLHVFYPP----EPLSSHQPVQTVASG 317

  Fly   199 STIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNY 263
            ....:.|.:...|.|:|| ||           |:.|     ..||.:|.|.:.|:.|...|.|.|
 Worm   318 RNTTVSCDVIANPTPTSY-TW-----------SKNG-----HYLPTQASSHIIISYAKPGDGGIY 365

  Fly   264 TCMLGN-----EITETVVVHVLNGEEP 285
            .|...|     .|.||   |::..|.|
 Worm   366 GCQADNIAGKGSIVET---HLIVAEPP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 19/84 (23%)
Ig 84..169 CDD:299845 19/89 (21%)
IG_like 191..279 CDD:214653 25/92 (27%)
Ig 201..274 CDD:143165 21/77 (27%)
igcm-2NP_001362087.1 IG_like 23..101 CDD:214653
Ig 124..200 CDD:386229 11/42 (26%)
IG_like 214..298 CDD:214653 24/106 (23%)
Ig_3 309..371 CDD:372822 21/78 (27%)
Ig 389..467 CDD:386229 1/1 (100%)
FN3 476..548 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.