DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and rig-4

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_501339.2 Gene:rig-4 / 177597 WormBaseID:WBGene00004371 Length:2325 Species:Caenorhabditis elegans


Alignment Length:273 Identity:55/273 - (20%)
Similarity:98/273 - (35%) Gaps:65/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 DTPEDEELEVTETTTHEP--FPFFADPYTTLNISTQL------------SSSVYLHCRVNDLQGK 104
            :||...:|:..:.:..:.  |||.::    |..|.:|            :..:.:.|........
 Worm   428 ETPPPRKLKFFDNSKSQEQLFPFTSE----LEPSQKLIKTPKDLTVASGTDRIMMECAATGSPPP 488

  Fly   105 TVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVL 169
            .:.|:..          |....:.:.:|.|    .|| .|.|....:.|||.|.|::|...    
 Worm   489 NIIWLLN----------GHEIQTDNVKYDL----TND-GLAIHDIRKSDEGEYTCEISGSN---- 534

  Fly   170 LVYLTIIVP-HVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRG 233
             |..|..|. :.:.|.|.|.|..:..  .|:.:|..|.::|.....:.:.|.....||..:.:  
 Worm   535 -VKATANVQVNGDSLIEYGPADQKSL--IGTNVEFSCEVAKEYVRKASVEWYLNDVLLPVNGN-- 594

  Fly   234 GISVKTDMLPGRALSR-----LYIANANRQDTGNYTCML---GNEITETVVVHVLNGEEPAAMQH 290
                     .|..:||     |.|......:||.|.|.:   |.|...:.::.::  |:||..:.
 Worm   595 ---------SGLRISRNRKGSLIIRQVGPDNTGEYRCRVTVDGREENASAMLQII--EKPAMPER 648

  Fly   291 ANGSRQKANASTM 303
            .   |.:.:..||
 Worm   649 V---RAELHNETM 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 16/91 (18%)
Ig 84..169 CDD:299845 17/96 (18%)
IG_like 191..279 CDD:214653 18/95 (19%)
Ig 201..274 CDD:143165 17/80 (21%)
rig-4NP_501339.2 IG_like 330..402 CDD:214653
IGc2 338..393 CDD:197706
I-set 459..543 CDD:254352 19/103 (18%)
IGc2 478..534 CDD:197706 15/70 (21%)
IG_like 553..639 CDD:214653 19/98 (19%)
Ig 564..635 CDD:143165 17/81 (21%)
FN3 643..747 CDD:238020 5/19 (26%)
FN3 756..850 CDD:238020
FN3 858..954 CDD:238020
FN3 959..1042 CDD:238020
FN3 1057..1151 CDD:238020
FN3 1156..1251 CDD:238020
FN3 1258..1356 CDD:238020
FN3 1361..1453 CDD:238020
FN3 1464..1560 CDD:238020
FN3 1572..1664 CDD:238020
FN3 1679..1764 CDD:238020
FN3 1774..1858 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.