DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and ver-1

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_497162.2 Gene:ver-1 / 175182 WormBaseID:WBGene00006894 Length:1083 Species:Caenorhabditis elegans


Alignment Length:372 Identity:85/372 - (22%)
Similarity:145/372 - (38%) Gaps:118/372 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPY----TTLNISTQLSSSVYLHCRV 98
            ||....||:  .:..:|.| |.:|.:.|..:   |..|...:    |.|||.. :|:|:.|   |
 Worm   446 DTSETIFWE--VAVESDYP-DVQLIIREPAS---FKVFGHQFYLLGTHLNIDC-VSTSIPL---V 500

  Fly    99 NDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSS 163
            :.|       :..|.::..:.|....::..|.    .||....:::::     .:....:|:|.:
 Worm   501 DAL-------LEYRKENFKIFTKVSRSFVADG----TFERKISYQVVL-----TENMMLKCRVGN 549

  Fly   164 HPPLVLLVYLTIIVPHVEI-LDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLN 227
            ...|. .|::...:|:::. |....||..|     |.|::|.||:.|:....| |||.|  |.|:
 Worm   550 RVALE-TVHVADEIPNIKFKLASNKSAIYE-----GDTVKLTCVVPKLAGRCS-ITWVH--RNLS 605

  Fly   228 YDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEITE----TVVVHV--------- 279
                   |...|::.....||.|||.||....:|||||:|.|:.:|    :.::.|         
 Worm   606 -------ILHSTEVTEHSQLSFLYIRNATTSASGNYTCVLENQASENFSLSTILKVEPIIAPYIV 663

  Fly   280 ---------------LNGEEPAAMQ-------HANGSR----QKANASTMVVLFLVYVCI----S 314
                           ::|..|...|       :..|.|    ::.|:.       :|.|:    :
 Worm   664 KTGFSAPTGSKLDCNIDGRPPPEYQWFKDGTPYGTGRRLKFFEEDNSG-------IYQCLATNRA 721

  Fly   315 GS------ISVAGMNRG---------LGLGQVWGW------GWELRR 340
            ||      :..||.:.|         ||:..:.||      ||:..|
 Worm   722 GSATNSFELKTAGRSYGIFVLLAILALGILVILGWKISTKLGWKKNR 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 17/93 (18%)
Ig strand B 92..96 CDD:409353 1/3 (33%)
Ig strand C 105..109 CDD:409353 0/3 (0%)
Ig strand E 142..146 CDD:409353 0/3 (0%)
Ig strand F 156..161 CDD:409353 1/4 (25%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 31/91 (34%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 3/5 (60%)
Ig strand E 248..252 CDD:409473 2/3 (67%)
Ig strand F 262..267 CDD:409473 4/4 (100%)
ver-1NP_497162.2 IG_like 578..654 CDD:214653 31/90 (34%)
Ig strand B 582..586 CDD:409353 1/3 (33%)
Ig strand C 596..600 CDD:409353 3/4 (75%)
Ig strand E 619..623 CDD:409353 2/3 (67%)
Ig strand F 633..638 CDD:409353 4/4 (100%)
Ig strand G 647..650 CDD:409353 0/2 (0%)
Ig 663..731 CDD:472250 10/74 (14%)
Ig strand B 674..677 CDD:409565 0/2 (0%)
Ig strand C 686..690 CDD:409565 1/3 (33%)
Ig strand F 712..717 CDD:409565 2/4 (50%)
Ig strand G 725..728 CDD:409565 0/2 (0%)
PTKc 807..1073 CDD:270623
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.