DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Kirrel

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus


Alignment Length:321 Identity:61/321 - (19%)
Similarity:101/321 - (31%) Gaps:79/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EELEVTETTTHEPFPFFADPY--------------TTLNI-------------STQLSSSVYLHC 96
            |:...:...|:..:.||.:|.              |.:|:             :|.:.|.|.|.|
Mouse   297 EDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPRIVVYPKPTTTDIGSDVTLTC 361

  Fly    97 RVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEE-PNDWKLLIQFANERDEGPYECQ 160
            ........|::|.::..:      .|..........:|..:. .|..:||::...:.|.|.|.|:
Mouse   362 VWVGNPPLTLTWTKKDSN------MGPRLPGSPPEANLSAQVLSNSNQLLLKSVTQADAGTYTCR 420

  Fly   161 VSSHPPLVLLVYLTIIVPHVEILDERG----------SATPEKYYKAGSTIELQCVISKIPHPSS 215
            .              |||.:.:.:...          |:...::...|...:::|.|...| |..
Mouse   421 A--------------IVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTP-PPD 470

  Fly   216 YITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQD-TGNYTCMLGNEITETVVVHV 279
            .|.|......|...|.......:|:...| .||.|.|.|....| ..:|.|...|.......:..
Mouse   471 RIAWAWKENFLEVGTLERYTVERTNSGSG-VLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQ 534

  Fly   280 LNGEEPAAMQHANGSRQKANASTMVV------LFLVYVCISGS----------ISVAGMNR 324
            |...|...:....|:  ...|..:||      :|.:|....||          |.|..:||
Mouse   535 LEEREVLPVGIIAGA--TIGAGILVVFSFAALVFFLYRRRKGSRKDVTLRKLDIKVETVNR 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 17/93 (18%)
Ig 84..169 CDD:299845 16/98 (16%)
IG_like 191..279 CDD:214653 20/88 (23%)
Ig 201..274 CDD:143165 19/73 (26%)
KirrelXP_011238330.1 Ig 54..148 CDD:386229
Ig2_KIRREL3-like 170..251 CDD:143236
Ig 255..336 CDD:386229 6/38 (16%)
Ig_3 340..421 CDD:372822 16/86 (19%)
Ig5_KIRREL3 439..536 CDD:143306 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.