DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and LOC1282038

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_061500784.1 Gene:LOC1282038 / 1282038 VectorBaseID:AGAMI1_009918 Length:467 Species:Anopheles gambiae


Alignment Length:72 Identity:14/72 - (19%)
Similarity:23/72 - (31%) Gaps:26/72 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YTTLNISTQLSSSVYLH--CRVNDLQGKTV-------------------SWMRR-----RGDDLT 117
            ||..:::..|:..||.:  .:..|:.||.:                   .|...     |..|..
Mosquito   109 YTYFSVANVLNPKVYTYTGSKTVDIAGKIILELGFCDLILIATERVYRGGWTTELLNAFRSVDKQ 173

  Fly   118 LITFGQH 124
            :|..|.|
Mosquito   174 IIALGAH 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 12/70 (17%)
Ig strand B 92..96 CDD:409353 2/5 (40%)
Ig strand C 105..109 CDD:409353 0/22 (0%)
Ig strand E 142..146 CDD:409353
Ig strand F 156..161 CDD:409353
Ig strand G 168..171 CDD:409353
IG_like 191..279 CDD:214653
Ig strand B 201..205 CDD:409473
Ig strand C 214..220 CDD:409473
Ig strand E 248..252 CDD:409473
Ig strand F 262..267 CDD:409473
LOC1282038XP_061500784.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.