DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and LOC110438474

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_021326636.1 Gene:LOC110438474 / 110438474 -ID:- Length:210 Species:Danio rerio


Alignment Length:210 Identity:54/210 - (25%)
Similarity:84/210 - (40%) Gaps:45/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHC 96
            ||.|      |.|::  ...:|:...||.|...:...:......|:|     :|..:...|.|:|
Zfish     2 RAED------KGFYR--CKVYTEQESDETLVQIKAVEYLSVSGSANP-----VSASVGEDVTLNC 53

  Fly    97 RVND----LQGKTVSWMRRRGDDLTLITFGQHTYS-GDSRY-------SLEFEEPNDWKLLIQFA 149
            .|..    .:.:.||| |:...:|.|:.|.::|.| ||.||       |.|..:.| :.:.::..
Zfish    54 SVKSHVPPEEIEQVSW-RKTDKNLQLLLFEKNTVSPGDERYRERVEFFSSEISKGN-FSVRLRSI 116

  Fly   150 NERDEGPYECQVS----SHPPLVLLVYLTIIVPHVEIL----DERGSA--------TPEKYYKAG 198
            ...|.|.|.|.|.    |...|.:|..|...|.|..:|    ...|||        ...:...|.
Zfish   117 RTEDAGVYMCLVKTGNFSASALAVLEKLGYSVLHTIVLIFCIAASGSALTLSVLWCRKMRSNNAN 181

  Fly   199 STIELQ-CVISKIPH 212
            :.:.|| ||:| :|:
Zfish   182 AALGLQMCVVS-VPN 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 26/95 (27%)
Ig 84..169 CDD:299845 28/100 (28%)
IG_like 191..279 CDD:214653 7/23 (30%)
Ig 201..274 CDD:143165 6/13 (46%)
LOC110438474XP_021326636.1 IG 40..142 CDD:214652 29/108 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303091at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.