DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and LOC103909461

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_021333840.1 Gene:LOC103909461 / 103909461 -ID:- Length:524 Species:Danio rerio


Alignment Length:278 Identity:56/278 - (20%)
Similarity:98/278 - (35%) Gaps:93/278 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FADPYTTLNISTQLSSSVYL----HCRVNDLQGKTVSWMRRRG-----DDLTLITFGQHT----Y 126
            ::.|:..|..||.:.|..|.    |..||      |.|.:.:.     |...|:...:::    |
Zfish   166 YSAPHCALKNSTVIMSCNYTYPTGHQIVN------VFWTKEKDRKEKEDHPDLLEDPEYSQRLQY 224

  Fly   127 SGD-SRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPP-----LVLLVYLTIIVPHVEILDE 185
            .|| .:||         .:.:....::||..|.|::.::.|     .|..|.|::....:|    
Zfish   225 LGDEQKYS---------TIRLSQVTKKDEHRYFCRIITNKPGGKWIDVTGVRLSVTDLQLE---- 276

  Fly   186 RGSATPEKYYKAGSTIELQCVIS-KIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSR 249
                :||:..: |.::.|.|..| |:....::|.:|:...|....|.                .:
Zfish   277 ----SPERVTE-GDSVRLTCRCSCKLTDTPTFIWYRNSHTLTEETTG----------------DK 320

  Fly   250 LYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVLFLVYVCIS 314
            |.:.:..|:|.|.|.|        .|..|.|...|                   |.|.::|...:
Zfish   321 LILKSVRREDAGRYRC--------AVNAHTLTSPE-------------------VYLNVMYPPRN 358

  Fly   315 GSISVAGMNRGLGLGQVW 332
            .|:|:...      ||:|
Zfish   359 VSVSITDS------GQLW 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 20/93 (22%)
Ig 84..169 CDD:299845 21/103 (20%)
IG_like 191..279 CDD:214653 18/88 (20%)
Ig 201..274 CDD:143165 14/73 (19%)
LOC103909461XP_021333840.1 Ig 177..271 CDD:325142 23/108 (21%)
IG_like 277..352 CDD:214653 23/118 (19%)
Ig_2 373..434 CDD:316418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303091at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.