DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and ntm

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:342 Identity:73/342 - (21%)
Similarity:115/342 - (33%) Gaps:122/342 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 FPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEF 136
            ||...|     |::.:...|..|.|.| |.:...|:|:.|.    |::..|...:|.|.|..|..
 Frog    39 FPKAMD-----NVTVRQGDSAILRCTV-DNRVTRVAWLNRS----TILYTGNDKWSIDPRVVLLA 93

  Fly   137 EEPNDWKLLIQFANERDEGPYEC--QVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGS 199
            ...:.:.:.||..:..|||||.|  |..:||. ...|:|.:.|| ..|:|...|....:    ||
 Frog    94 NTKSQYSIEIQNVDIYDEGPYTCSVQTDNHPK-TSRVHLIVQVP-PRIVDISSSIAVNE----GS 152

  Fly   200 TIELQCVISKIPHPSSYITWRH-GPR--------------------------------------- 224
            .:.|.|:.:..|.|  .:.||: .|:                                       
 Frog   153 NVSLICIANGRPEP--VVNWRYLSPKARGFVSEDEYLEITGITREQSGIYECSASNDVSAPDVRR 215

  Fly   225 ---LLNYDT-------------SRGGISVKTDMLPG------------------------RALSR 249
               .:||..             .||.:..:...:|.                        ..:||
 Frog   216 VKLTVNYPPYILDAQNIGAPLGHRGILQCEASAVPAADFFWYKEDKRLSDSWRGVKVENRETISR 280

  Fly   250 LYIANANRQDTGNYTCMLGN------------EITETVVVHVLNGEE---------PAAMQHAN- 292
            :...|.:.||.||||||..|            |:.::....:|..|.         |.|:...| 
 Frog   281 VTFLNVSEQDYGNYTCMAKNLLGHSNASIILFELFQSTSSPLLQEESTAALTPLKGPGAVHDGNS 345

  Fly   293 GSRQKANASTMVVLFLV 309
            ||.|.:..:.:::|.|:
 Frog   346 GSTQCSFCAPLLILLLL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 24/81 (30%)
Ig 84..169 CDD:299845 25/86 (29%)
IG_like 191..279 CDD:214653 27/179 (15%)
Ig 201..274 CDD:143165 25/164 (15%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 28/93 (30%)
IG_like 45..133 CDD:214653 28/93 (30%)
IG_like 143..220 CDD:214653 10/82 (12%)
IGc2 150..209 CDD:197706 9/64 (14%)
ig 227..311 CDD:278476 15/83 (18%)
IG_like 230..311 CDD:214653 15/80 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.