DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and cadm4

DIOPT Version :10

Sequence 1:NP_572419.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_002939173.1 Gene:cadm4 / 100488420 XenbaseID:XB-GENE-992659 Length:394 Species:Xenopus tropicalis


Alignment Length:334 Identity:65/334 - (19%)
Similarity:104/334 - (31%) Gaps:128/334 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NISTQLSSSVYLHCRVNDLQGKTV---SWMRRRGDDLTLITFGQHTYSGDSRYSL-EFEEPNDWK 143
            |::.....:..:.|.::...|..|   :.:|:     ||...|..... |:|:.| ||.: ...|
 Frog    38 NVTVVEGGTAEISCHLHQYDGSIVVIQNPVRQ-----TLFFNGTRALK-DTRFQLVEFTQ-KVVK 95

  Fly   144 LLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVP------------------------------ 178
            :.:..|...|||.|.||:.:......:..||:|||                              
 Frog    96 IHLSDAKLEDEGGYFCQLYTEDTHHQIATLTVIVPPDNPLVEVKEQAVEGGEIELTCISPRTRPA 160

  Fly   179 ---------------------------------HVEILDERGSATPEKYYKA------------- 197
                                             .|:..|:|...|.|..:.|             
 Frog   161 ATLRWYRDRKELKGFTSKQENGKTFSITNSIRFSVDRKDDRDIVTCEASHPALKGQKKQTQYELD 225

  Fly   198 ------------------GSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPG 244
                              |..:.|:|.::..|.|:..|..|     ||            |.||.
 Frog   226 VQFSPTANIQPSQSLVREGDELNLKCEVTGNPRPTEIIWTR-----LN------------DSLPE 273

  Fly   245 RALSR---LYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVL 306
            ||..:   |...:.:.||.|.|:|.:.|:...:...:||...:|.|:..|......|....::.|
 Frog   274 RAQIQGDVLSFPSLSLQDNGTYSCQVSNKHGRSSDQYVLVVYDPGAIIEAQTQVPYAVIGGILAL 338

  Fly   307 --FLVYVCI 313
              ||| :||
 Frog   339 LVFLV-ICI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_572419.1 Ig 81..175 CDD:472250 22/95 (23%)
Ig strand B 92..96 CDD:409353 0/3 (0%)
Ig strand C 105..109 CDD:409353 1/6 (17%)
Ig strand E 142..146 CDD:409353 1/3 (33%)
Ig strand F 156..161 CDD:409353 2/4 (50%)
Ig strand G 168..171 CDD:409353 0/2 (0%)
IG_like 191..279 CDD:214653 23/121 (19%)
Ig strand B 201..205 CDD:409473 1/3 (33%)
Ig strand C 214..220 CDD:409473 1/5 (20%)
Ig strand E 248..252 CDD:409473 1/6 (17%)
Ig strand F 262..267 CDD:409473 2/4 (50%)
cadm4XP_002939173.1 IgI_2_Necl-4 128..226 CDD:409468 9/97 (9%)
Ig strand A 128..131 CDD:409468 2/2 (100%)
Ig strand A' 134..138 CDD:409468 0/3 (0%)
Ig strand B 146..156 CDD:409468 0/9 (0%)
Ig strand C 159..168 CDD:409468 0/8 (0%)
Ig strand C' 169..172 CDD:409468 0/2 (0%)
Ig strand D 174..181 CDD:409468 0/6 (0%)
Ig strand E 184..194 CDD:409468 0/9 (0%)
Ig strand F 202..210 CDD:409468 2/7 (29%)
Ig strand G 218..225 CDD:409468 0/6 (0%)
Ig_3 230..301 CDD:464046 20/87 (23%)
4.1m 350..368 CDD:128590
Ig 37..127 CDD:472250 22/95 (23%)
Ig strand B 47..51 CDD:409353 0/3 (0%)
Ig strand C 60..64 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 120..123 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.