| Sequence 1: | NP_572419.1 | Gene: | dpr14 / 31702 | FlyBaseID: | FBgn0029974 | Length: | 340 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002939173.1 | Gene: | cadm4 / 100488420 | XenbaseID: | XB-GENE-992659 | Length: | 394 | Species: | Xenopus tropicalis |
| Alignment Length: | 334 | Identity: | 65/334 - (19%) |
|---|---|---|---|
| Similarity: | 104/334 - (31%) | Gaps: | 128/334 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 83 NISTQLSSSVYLHCRVNDLQGKTV---SWMRRRGDDLTLITFGQHTYSGDSRYSL-EFEEPNDWK 143
Fly 144 LLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVP------------------------------ 178
Fly 179 ---------------------------------HVEILDERGSATPEKYYKA------------- 197
Fly 198 ------------------GSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPG 244
Fly 245 RALSR---LYIANANRQDTGNYTCMLGNEITETVVVHVLNGEEPAAMQHANGSRQKANASTMVVL 306
Fly 307 --FLVYVCI 313 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr14 | NP_572419.1 | Ig | 81..175 | CDD:472250 | 22/95 (23%) |
| Ig strand B | 92..96 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 105..109 | CDD:409353 | 1/6 (17%) | ||
| Ig strand E | 142..146 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 156..161 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 168..171 | CDD:409353 | 0/2 (0%) | ||
| IG_like | 191..279 | CDD:214653 | 23/121 (19%) | ||
| Ig strand B | 201..205 | CDD:409473 | 1/3 (33%) | ||
| Ig strand C | 214..220 | CDD:409473 | 1/5 (20%) | ||
| Ig strand E | 248..252 | CDD:409473 | 1/6 (17%) | ||
| Ig strand F | 262..267 | CDD:409473 | 2/4 (50%) | ||
| cadm4 | XP_002939173.1 | IgI_2_Necl-4 | 128..226 | CDD:409468 | 9/97 (9%) |
| Ig strand A | 128..131 | CDD:409468 | 2/2 (100%) | ||
| Ig strand A' | 134..138 | CDD:409468 | 0/3 (0%) | ||
| Ig strand B | 146..156 | CDD:409468 | 0/9 (0%) | ||
| Ig strand C | 159..168 | CDD:409468 | 0/8 (0%) | ||
| Ig strand C' | 169..172 | CDD:409468 | 0/2 (0%) | ||
| Ig strand D | 174..181 | CDD:409468 | 0/6 (0%) | ||
| Ig strand E | 184..194 | CDD:409468 | 0/9 (0%) | ||
| Ig strand F | 202..210 | CDD:409468 | 2/7 (29%) | ||
| Ig strand G | 218..225 | CDD:409468 | 0/6 (0%) | ||
| Ig_3 | 230..301 | CDD:464046 | 20/87 (23%) | ||
| 4.1m | 350..368 | CDD:128590 | |||
| Ig | 37..127 | CDD:472250 | 22/95 (23%) | ||
| Ig strand B | 47..51 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 60..64 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 94..98 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 108..113 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 120..123 | CDD:409353 | 0/2 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||