DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and iglon5

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:302 Identity:69/302 - (22%)
Similarity:111/302 - (36%) Gaps:84/302 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPN 140
            ||.||     .....:..|.|.::| :...|:|:.|.    .::..|:..:|.|||..|.....:
 Frog    33 ADNYT-----VSQGDNATLSCLIDD-KVTRVAWLNRS----NILYAGKDKWSIDSRVQLLTNTKS 87

  Fly   141 DWKLLIQFANERDEGPYECQVSSH-PPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQ 204
            ::.::|...:..|||.|.|...:. .|....|||.:.|| .:|::...|.|..:    ||.:.||
 Frog    88 EYSIVITHVDVADEGLYTCSFQTEDKPHTSQVYLIVQVP-AKIVNISSSVTVNE----GSNVNLQ 147

  Fly   205 CVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGN 269
            |:....|.|:  |||:   :|....:|.|.:              |.|...|||..|:|.|:..|
 Frog   148 CLAVGKPEPT--ITWQ---QLSEGFSSEGEL--------------LEITEINRQQAGDYECVTSN 193

  Fly   270 EI----TETV---------VVHVLNGEEPAA---------------------------MQHANGS 294
            .:    |:.|         :..|.|.:.|..                           :....|.
 Frog   194 GVSVPDTKKVQITVNYPPYITDVKNAQSPVGRPATLRCKAMAVPPAEFEWYKDEKRRLISGTEGL 258

  Fly   295 RQKANASTMVVLFL--------VYVCISGSISVAGMNRGLGL 328
            ..|..:|..|::|.        .|.|:: |..:...|..|.|
 Frog   259 SIKTESSWSVIVFSNVTSRHYGNYTCLA-SNKLGSFNSSLRL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 18/79 (23%)
Ig 84..169 CDD:299845 19/85 (22%)
IG_like 191..279 CDD:214653 24/100 (24%)
Ig 201..274 CDD:143165 21/76 (28%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 26/99 (26%)
IG_like 35..123 CDD:214653 24/97 (25%)
Ig 126..207 CDD:299845 28/104 (27%)
I-set 128..207 CDD:254352 27/101 (27%)
I-set 210..299 CDD:254352 13/89 (15%)
Ig 227..298 CDD:143165 9/71 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.