DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and Kirrel2

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_038957463.1 Gene:Kirrel2 / 100359836 RGDID:1308456 Length:711 Species:Rattus norvegicus


Alignment Length:353 Identity:74/353 - (20%)
Similarity:112/353 - (31%) Gaps:131/353 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WQEFSSPFTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQ------- 102
            |.:..||.... ....|||....|     |..:|     :|.::|::|....|...|:       
  Rat   269 WAKGGSPVLGA-RGPRLEVVADAT-----FLTEP-----VSCEVSNAVGSANRSTALEVLYGPIL 322

  Fly   103 -----------GKTVS----WMRRRGDDLTLITF-----GQHTYSGDSRYSLEFEEPNDWKLLIQ 147
                       ||..|    |   ||:.|..|::     .|...||.:             |.:.
  Rat   323 QAKPKPVSVDVGKDASFSCVW---RGNPLPRISWTRLGGSQVLSSGPT-------------LRLP 371

  Fly   148 FANERDEGPYECQVS-----------------SHPPLVLLVYLTIIVPHVEILDERGSATPEKYY 195
            .....|.|.|.|:..                 :.||:|     |.:.|....|  ||.|      
  Rat   372 SVALEDAGDYVCRAEPRRTGVGGGTAQARLTVNAPPVV-----TALHPAPAFL--RGPA------ 423

  Fly   196 KAGSTIELQCVISKIPHPSSYI-TWRHG-----------------PRLLNYDTSRGGISVKTDML 242
                  .||||:...|.|.|.: :|..|                 |.:      .||..      
  Rat   424 ------RLQCVVFASPAPDSVVWSWDEGFLEAGSLGRFLVEAFPAPEV------EGGQG------ 470

  Fly   243 PGRALSRLYIANANRQD-TGNYTCMLGNEITE-TVVVHVLNGEEPAAMQHANGSRQKANASTMVV 305
            || .:|.|:|:.....| |..:.|...|.:.| .|.:|:...:....::...|:...|.:..||:
  Rat   471 PG-LISVLHISGTQESDFTTGFNCSARNRLGEGRVQIHLGRRDLLPTVRLVAGAASAATSLFMVI 534

  Fly   306 LFLVYVC-ISGSIS-------VAGMNRG 325
            ..:|..| ..||:|       :.|.:.|
  Rat   535 TGVVLCCWRHGSLSKQKNLVRIPGSSEG 562

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 21/123 (17%)
Ig 84..169 CDD:299845 23/128 (18%)
IG_like 191..279 CDD:214653 23/107 (21%)
Ig 201..274 CDD:143165 22/92 (24%)
Kirrel2XP_038957463.1 IG_like 38..127 CDD:214653
Ig strand A' 40..44 CDD:409353
Ig strand B 48..57 CDD:409353
Ig strand C 62..66 CDD:409353
Ig strand D 75..85 CDD:409353
Ig strand E 88..100 CDD:409353
Ig strand F 107..115 CDD:409353
Ig strand G 117..127 CDD:409353
Ig 133..231 CDD:416386
Ig strand A 134..137 CDD:409353
Ig strand A' 140..144 CDD:409353
Ig strand B 151..158 CDD:409353
Ig strand C 164..169 CDD:409353
Ig strand C' 172..174 CDD:409353
Ig strand D 177..184 CDD:409353
Ig strand E 191..199 CDD:409353
Ig strand F 208..216 CDD:409353
Ig strand G 222..228 CDD:409353
Ig_3 234..303 CDD:404760 10/44 (23%)
Ig strand B 252..256 CDD:409353