DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and kirrel1b

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:307 Identity:72/307 - (23%)
Similarity:109/307 - (35%) Gaps:86/307 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WILAIIYSSLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSSPFTDTPEDEELEVTETTTHEP 71
            ||:.:...|:|.:.||        ||                   |:..|.|:.:.:.|      
Zfish     9 WIVTLAIISVHRVFSG--------PR-------------------FSQEPADQSVVIGE------ 40

  Fly    72 FPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEF 136
                               .|.|.|.|.:..| .|.|.:   |.|.| ..|:...:......|..
Zfish    41 -------------------RVVLSCVVFNYTG-IVQWTK---DGLAL-GIGEDLRAWPRYRVLRI 81

  Fly   137 EEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTI 201
            .:...:.|.|..|:..|:..||||.:..........||:::|....:.|   .:||....||::.
Zfish    82 MDVGQYNLEITSADLTDDSLYECQATEAALRSRRAKLTVLIPPDGPVIE---GSPEILLTAGTSF 143

  Fly   202 ELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGR----ALSRLYIANANRQDTG- 261
            .|.|| |:...|.|.|.|.....::.      |....|::|..|    ..|.|.|...: .||| 
Zfish   144 NLTCV-SRGAKPMSTIEWYKDGIIVE------GAHTSTEVLSDRKRVTTKSFLEIQPMD-TDTGR 200

  Fly   262 NYTCM-------LGNEITETVVVH----VLNGEEPAAMQHANGSRQK 297
            |:||:       ||...|.|:.:|    |:...||.::  ..|.|.|
Zfish   201 NFTCVASNLAAPLGKRSTVTLNIHHPPTVILSIEPRSV--LEGERVK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 20/79 (25%)
Ig 84..169 CDD:299845 20/84 (24%)
IG_like 191..279 CDD:214653 30/103 (29%)
Ig 201..274 CDD:143165 24/84 (29%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.