DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr14 and ncam2

DIOPT Version :9

Sequence 1:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_012811963.1 Gene:ncam2 / 100151722 XenbaseID:XB-GENE-1217730 Length:865 Species:Xenopus tropicalis


Alignment Length:192 Identity:48/192 - (25%)
Similarity:75/192 - (39%) Gaps:45/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQF 148
            :...:..|.|..|.|.. :...:.|...:|:.   |..||       |..::.|....| |.|..
 Frog    59 VEISVGQSKYFTCTVIG-EADNIDWFNPQGEK---IISGQ-------RVVVQREGIRSW-LTIYK 111

  Fly   149 ANERDEGPYECQV------SSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVI 207
            ||..|.|.|.||.      :....:||.:|..:....|        .:|:: :|.|...|:.|::
 Frog   112 ANVDDAGIYRCQATDSKGHAQEATVVLEIY
QKLTFEDV--------PSPQE-FKRGENAEVLCLV 167

  Fly   208 SKIPHPSSYITWRHGPRLLNYDTSRGGISVKTD----MLPGRALSRLYIANANRQDTGNYTC 265
            |..|.|  .:.|      ||   :|..::...|    |||.   :.|.|.|.:::|.|.|.|
 Frog   168 SSSPAP--MVRW------LN---NREDVTDIDDRRFAMLPN---NNLQIKNISKRDEGIYRC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 21/84 (25%)
Ig 84..169 CDD:299845 21/90 (23%)
IG_like 191..279 CDD:214653 23/79 (29%)
Ig 201..274 CDD:143165 20/69 (29%)
ncam2XP_012811963.1 Ig 50..141 CDD:386229 23/93 (25%)
IG_like 150..234 CDD:214653 23/81 (28%)
Ig 237..330 CDD:386229
Ig 329..426 CDD:386229
IG_like 442..520 CDD:214653
FN3 525..617 CDD:238020
fn3 623..706 CDD:365830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.