DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS6 and rps6

DIOPT Version :9

Sequence 1:NP_511073.1 Gene:RpS6 / 31700 FlyBaseID:FBgn0261592 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_989152.1 Gene:rps6 / 394757 XenbaseID:XB-GENE-1003287 Length:249 Species:Xenopus tropicalis


Alignment Length:250 Identity:186/250 - (74%)
Similarity:214/250 - (85%) Gaps:3/250 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLNVSYPATGCQKLFEVVDEHKLRVFYEKRMGQVVEADILGDEWKGYQLRIAGGNDKQGFPMKQ 65
            ||||:|:||||||||.||.||.|||.||||||...|.||.||||||||.:||:||||||||||||
 Frog     1 MKLNISFPATGCQKLIEVEDERKLRTFYEKRMATEVAADPLGDEWKGYVVRISGGNDKQGFPMKQ 65

  Fly    66 GVLTHGRVRLLLKKGHSCYRPRRTGERKRKSVRGCIVDANMSVLALVVLKKGEKDIPGLTDTTIP 130
            ||||||||||||.|||||||||||||||||||||||||||:|||.||:::|||||||||||.|:|
 Frog    66 GVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVRKGEKDIPGLTDNTVP 130

  Fly   131 RRLGPKRASKIRKLYNLSKEDDVRRFVVRRPLPAKDNKKATSKAPKIQRLITPVVLQRKHRRIAL 195
            |||||||||:||||:|||||||||::|||:|| ||:.||..:||||||||:||.|||.|.|||||
 Frog   131 RRLGPKRASRIRKLFNLSKEDDVRQYVVRKPL-AKEGKKPRTKAPKIQRLVTPRVLQHKRRRIAL 194

  Fly   196 KKKRQIASKEASADYAKLLVQRKKESKAKREE--AKRRRSASIRESKSSVSSDKK 248
            ||:|...:||.:::|||||.:|.||:|.||:|  |||||.:|:|.|.|...|.:|
 Frog   195 KKQRTQKNKEEASEYAKLLAKRTKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS6NP_511073.1 Ribosomal_S6e 1..222 CDD:294602 171/220 (78%)
rps6NP_989152.1 Ribosomal_S6e 1..215 CDD:382290 168/214 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 223 1.000 Domainoid score I2520
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H85949
Inparanoid 1 1.050 345 1.000 Inparanoid score I2267
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326714at2759
OrthoFinder 1 1.000 - - FOG0003187
OrthoInspector 1 1.000 - - oto102870
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1248
SonicParanoid 1 1.000 - - X2145
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.