| Sequence 1: | NP_863651.1 | Gene: | APAF1 / 317 | HGNCID: | 576 | Length: | 1248 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
| Alignment Length: | 330 | Identity: | 93/330 - (28%) |
|---|---|---|---|
| Similarity: | 165/330 - (50%) | Gaps: | 33/330 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Human 599 NKKNITNLSRLVVRP----------HTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEI 653
Human 654 KAHEDEVLCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLAT 718
Human 719 GSSDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKSINV 783
Human 784 KQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAA-KNKIFLFDIHTSGLLGEIHTGHHSTIQYC- 846
Human 847 --DFSPQNHLAVVALSQ-YCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTSS--DDQTI 906
Human 907 RLWET 911 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| APAF1 | NP_863651.1 | CARD_APAF1 | 7..92 | CDD:260034 | |
| NB-ARC | 129..374 | CDD:395745 | |||
| APAF1_C | 453..587 | CDD:407760 | |||
| WD40 | 607..910 | CDD:238121 | 91/319 (29%) | ||
| WD 1-1 | 613..652 | 15/48 (31%) | |||
| WD40 repeat | 623..655 | CDD:293791 | 11/31 (35%) | ||
| WD 1-2 | 655..694 | 12/38 (32%) | |||
| WD40 repeat | 660..697 | CDD:293791 | 12/36 (33%) | ||
| WD 1-3 | 697..738 | 14/40 (35%) | |||
| WD40 repeat | 703..741 | CDD:293791 | 12/37 (32%) | ||
| WD 1-4 | 741..780 | 12/38 (32%) | |||
| WD40 repeat | 746..791 | CDD:293791 | 12/44 (27%) | ||
| WD 1-5 | 796..836 | 8/40 (20%) | |||
| WD40 repeat | 802..870 | CDD:293791 | 20/72 (28%) | ||
| WD 1-6 | 838..877 | 13/42 (31%) | |||
| WD 1-7 | 880..910 | 8/31 (26%) | |||
| WD40 repeat | 885..939 | CDD:293791 | 7/29 (24%) | ||
| Interpropeller linker. /evidence=ECO:0000250 | 910..921 | 0/2 (0%) | |||
| WD 2-1 | 922..958 | ||||
| WD 2-2 | 959..998 | ||||
| WD40 | 961..1234 | CDD:238121 | |||
| WD40 repeat | 964..990 | CDD:293791 | |||
| WD 2-3 | 1001..1040 | ||||
| WD40 repeat | 1006..1030 | CDD:293791 | |||
| WD 2-4 | 1042..1080 | ||||
| WD40 repeat | 1047..1082 | CDD:293791 | |||
| WD 2-5 | 1083..1122 | ||||
| WD40 repeat | 1089..1124 | CDD:293791 | |||
| WD 2-6 | 1125..1164 | ||||
| WD40 repeat | 1130..1172 | CDD:293791 | |||
| WD 2-7 | 1175..1212 | ||||
| WD40 repeat | 1180..1213 | CDD:293791 | |||
| WD 2-8 | 1213..1248 | ||||
| wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 87/309 (28%) |
| WD40 repeat | 75..112 | CDD:293791 | 12/36 (33%) | ||
| WD40 repeat | 118..154 | CDD:293791 | 12/35 (34%) | ||
| WD40 repeat | 159..195 | CDD:293791 | 13/37 (35%) | ||
| WD40 repeat | 202..237 | CDD:293791 | 11/42 (26%) | ||
| WD40 repeat | 244..280 | CDD:293791 | 8/40 (20%) | ||
| WD40 repeat | 288..325 | CDD:293791 | 10/36 (28%) | ||
| WD40 repeat | 331..357 | CDD:293791 | 5/25 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||