DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-MNLL and ndufb1

DIOPT Version :9

Sequence 1:NP_001162693.1 Gene:ND-MNLL / 31697 FlyBaseID:FBgn0029971 Length:56 Species:Drosophila melanogaster
Sequence 2:XP_002933251.1 Gene:ndufb1 / 100485816 XenbaseID:XB-GENE-982989 Length:58 Species:Xenopus tropicalis


Alignment Length:40 Identity:16/40 - (40%)
Similarity:26/40 - (65%) Gaps:1/40 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGFAIGHFLDKKETERMTMFRDKSALYGRPAGSEGKAPSW 56
            :||.||.:||::..|:::.||:||.||.|.. ..|:..:|
 Frog    19 VGFVIGWYLDRRNDEKLSTFRNKSMLYKREL-KPGEEVTW 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-MNLLNP_001162693.1 NADH_oxidored <17..56 CDD:285307 15/38 (39%)
ndufb1XP_002933251.1 NADH_oxidored 1..58 CDD:369665 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007979
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5921
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.