powered by:
Protein Alignment ND-MNLL and ndufb1
DIOPT Version :9
Sequence 1: | NP_001162693.1 |
Gene: | ND-MNLL / 31697 |
FlyBaseID: | FBgn0029971 |
Length: | 56 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002933251.1 |
Gene: | ndufb1 / 100485816 |
XenbaseID: | XB-GENE-982989 |
Length: | 58 |
Species: | Xenopus tropicalis |
Alignment Length: | 40 |
Identity: | 16/40 - (40%) |
Similarity: | 26/40 - (65%) |
Gaps: | 1/40 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 LGFAIGHFLDKKETERMTMFRDKSALYGRPAGSEGKAPSW 56
:||.||.:||::..|:::.||:||.||.|.. ..|:..:|
Frog 19 VGFVIGWYLDRRNDEKLSTFRNKSMLYKREL-KPGEEVTW 57
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007979 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5921 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.