DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Rcc1l

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_291050.1 Gene:Rcc1l / 94254 MGIID:2137600 Length:461 Species:Mus musculus


Alignment Length:30 Identity:12/30 - (40%)
Similarity:15/30 - (50%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQDYEVLAVMGNGSFGTCYK--VRDKSTGE 43
            |.|.|.:..|||.|.|.|.:  |.|:...|
Mouse   186 LTDREGVFSMGNNSHGQCGRKVVEDEVYSE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 11/28 (39%)
S_TKc 19..281 CDD:214567 10/27 (37%)
Rcc1lNP_291050.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
RCC1 1. /evidence=ECO:0000255 55..121
RCC1 2. /evidence=ECO:0000255 125..188 1/1 (100%)
RCC1 127..186 CDD:278826 12/30 (40%)
RCC1_2 173..202 CDD:290274 7/15 (47%)
RCC1 3. /evidence=ECO:0000255 190..244 10/26 (38%)
RCC1 192..242 CDD:278826 9/24 (38%)
RCC1_2 229..258 CDD:290274
RCC1 4. /evidence=ECO:0000255 245..297
RCC1 245..295 CDD:278826
RCC1 5. /evidence=ECO:0000255 298..350
RCC1 298..348 CDD:278826
RCC1 6. /evidence=ECO:0000255 352..408
RCC1_2 393..422 CDD:290274
RCC1 7. /evidence=ECO:0000255 409..458
RCC1 409..452 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.