DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and AT1G65920

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_176767.1 Gene:AT1G65920 / 842904 AraportID:AT1G65920 Length:1006 Species:Arabidopsis thaliana


Alignment Length:700 Identity:134/700 - (19%)
Similarity:219/700 - (31%) Gaps:244/700 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ESAGMDFSQKTLQDYEVLAVMGNGSF-------GTCYKVRDKSTGELFAWKGMNYDELDEAKCDA 62
            |.:|..|..:.:.|     |:| ||.       |..:.....|:|:||.:....:..|.....::
plant   376 EQSGSQFLTRKISD-----VLG-GSLTVLSVACGAWHTAIVTSSGQLFTYGSGTFGVLGHGSLES 434

  Fly    63 LV--SEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQR----QRFEE 121
            :.  .|:..||:::                    ::...|.....|.||:.|..::    :...:
plant   435 VTKPKEVESLRRMK--------------------VISVSCGPWHTAAIVETANDRKFYNAKSCGK 479

  Fly   122 PYIW--------------RVLFQLCRALQVCHNKIP-------------NGTI------LHRDI- 152
            .:.|              |.|...|....:.|:.|.             :||:      :|..: 
plant   480 LFTWGDGDKGRLGHADSKRKLVPTCVTELIDHDFIKVSCGWTLTVALSISGTVYTMGSSIHGQLG 544

  Fly   153 ------KPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHY---------------MSPE 196
                  |..|:.|   ||       |.|...:|   .||  |:.|.               |:.:
plant   545 CPRAKDKSVNVVL---GN-------LTRQFVKD---IAS--GSHHVAVLTSFGNVYTWGKGMNGQ 594

  Fly   197 LVKGRKYDRKSDV-------------------WAVGCLVYEM----------CALRPPFRGRAF- 231
            |..|...||.|.|                   .|..||..|:          |.....|..|.. 
plant   595 LGLGDVRDRNSPVLVEPLGDRLVESIACGLNLTAAICLHKEISLNDQTACSSCKSAFGFTRRKHN 659

  Fly   232 ---------DQLSEKIA--------QGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEVIIRHP 279
                     :..|.|.|        :.:.||:.......|..|..|...|..:....     |..
plant   660 CYNCGLLFCNACSSKKAVNASLAPNKSKLSRVCDSCFDHLWSITEFSRNVKMDNHTP-----RMQ 719

  Fly   280 LVVRNISE-LDGKFPILVDSGEDFYTLPSGARLFEDEEEDGVHPELSSTMF---TEQYSFNEGYG 340
            :|.|.:|| |..|     .|..:...||...|..:.:...|.....|...|   :...|.|....
plant   720 MVTRRVSEDLTEK-----QSENEMQNLPQANRSSDGQPRWGQVSGPSLFRFDKISTSSSLNLSVS 779

  Fly   341 QRRLSVTGVFTPDLRSELFYSAKRKIFPAKKLQLSDPSLYESIRRE-----ERAEERQVELAEE- 399
            .||.|.|.:.|.        |...||...:..:|.  ::.::::|:     |:.||.|.||.:. 
plant   780 ARRTSSTKISTS--------SESNKILTEEIERLK--AVIKNLQRQCELGNEKMEECQQELDKTW 834

  Fly   400 RRRKKDQEQQKRDQELL----------KEAPSSP--------RALTQNIFDEVLK----TRLHAI 442
            ...|::.|:.|..:|::          ||.||:|        .:....|||:.:.    |.:...
plant   835 EVAKEEAEKSKAAKEIIKALASKLQANKEKPSNPLKTGIACNPSQVSPIFDDSMSIPYLTPITTA 899

  Fly   443 RAQESLLQQKLEELQT----REQELQLAEQRVQTLERQMQEKLLQQEKHTCSCRQPIAPPIPPRK 503
            |:|.. .:|.:|:..|    |:..::|.......:.|   ...||.|....|..|          
plant   900 RSQHE-TKQHVEKCVTKSSNRDSNIKLLVDASPAITR---TGYLQNETQDSSAEQ---------- 950

  Fly   504 PAKSHHDDTYCTIELNETSPTVAKLNLATLPAPKSLNTLRKVTFKSPQKF 553
             .:.:....|.|              ...||..:  .||::|.| |.::|
plant   951 -VEQYEPGVYIT--------------FTALPCGQ--KTLKRVRF-SRKRF 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 64/377 (17%)
S_TKc 19..281 CDD:214567 63/376 (17%)
AT1G65920NP_176767.1 PH_PLC_plant-like 14..126 CDD:270171
ATS1 <291..646 CDD:227511 54/310 (17%)
FYVE 639..699 CDD:366594 8/59 (14%)
Smc <798..>864 CDD:224117 13/67 (19%)
BRX_N 839..874 CDD:372684 8/34 (24%)
BRX 948..1001 CDD:369842 10/62 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.