DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and AT5G16040

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_197108.1 Gene:AT5G16040 / 831461 AraportID:AT5G16040 Length:396 Species:Arabidopsis thaliana


Alignment Length:113 Identity:23/113 - (20%)
Similarity:43/113 - (38%) Gaps:27/113 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KTLQDYEVL-AVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPN 77
            |:|.:.::: |.:|...   |..|.|:  |..:||.|..|     .:|....|:....|.::...
plant    86 KSLANVKIVQAAIGGWH---CLAVDDQ--GRAYAWGGNEY-----GQCGEEPSKDETGRPVRRDI 140

  Fly    78 IVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIW 125
            ::.       :.......|.:..|||..:.::.|         |.|:|
plant   141 VIP-------KRCAQQLTVRQVAAGGTHSVVLTR---------EGYVW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 21/109 (19%)
S_TKc 19..281 CDD:214567 21/108 (19%)
AT5G16040NP_197108.1 ATS1 6..339 CDD:227511 23/113 (20%)
RCC1 320..385 CDD:395335
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.