DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and RUG1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_680156.2 Gene:RUG1 / 830771 AraportID:AT5G08710 Length:434 Species:Arabidopsis thaliana


Alignment Length:83 Identity:22/83 - (26%)
Similarity:34/83 - (40%) Gaps:14/83 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 VVRNISELDGKFPILVDSGEDFYTLPSGARLFED--EEEDGVHPELSSTMFTEQYSFNEGYGQRR 343
            ::|:.||..   |.|:...|........|.|...  .:|:|     |:.||.|:.....|:|   
plant   231 ILRSNSEFT---PRLIKELEGIKVTNVAAGLLHSACTDENG-----SAFMFGEKSINKMGFG--- 284

  Fly   344 LSVTGVFTPDLRSELFYS 361
             .|....||.:.||:.|:
plant   285 -GVRNATTPSIISEVPYA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 22/83 (27%)
S_TKc 19..281 CDD:214567 22/83 (27%)
RUG1NP_680156.2 RCC1 54..97 CDD:395335
ATS1 93..432 CDD:227511 22/83 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.