DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and AT3G53830

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001327553.1 Gene:AT3G53830 / 824550 AraportID:AT3G53830 Length:500 Species:Arabidopsis thaliana


Alignment Length:185 Identity:39/185 - (21%)
Similarity:56/185 - (30%) Gaps:69/185 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 RQPIAPPIPPRKPAKSHHDDTY-------C--TIELNETSPTVAKLNLATLPAPKSLNTLRKVTF 547
            :.||..|:|.|..|..|..|::       |  .:.::|      |..|.|..:          |.
plant    32 KSPILSPVPVRLSAAVHGGDSWKDVCGGGCGFAMAISE------KGKLITWGS----------TD 80

  Fly   548 KSPQKFVTYG-----IENMPPPAVKPAVNP----------PPTG----------VPMQMSVSSND 587
            ...|.:|..|     .|..|.|...|.|..          ..||          :|.:..|....
plant    81 DEGQSYVASGKHGETPEPFPLPTEAPVVQASSGWAHCAVVTETGEAFTWGWKECIPSKDPVGKQQ 145

  Fly   588 SGDSQASSTR------------------RKSILSLFGLSRGSKATS-KSLPSVNQ 623
            ||.|:.....                  ..||:.:...|:||.|.| .:|.:.||
plant   146 SGSSEQGDIGWDIFGCSVVIFLLLMDMVTFSIVIVSPASQGSNAASGTTLQNENQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857
S_TKc 19..281 CDD:214567
AT3G53830NP_001327553.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.