DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and AT3G23270

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001327882.1 Gene:AT3G23270 / 821906 AraportID:AT3G23270 Length:1054 Species:Arabidopsis thaliana


Alignment Length:247 Identity:57/247 - (23%)
Similarity:81/247 - (32%) Gaps:69/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 HTCSCRQPIAPPIPPRKPAKSHH--DDTYCTIELNET--SPTVAKLNLAT--------------- 532
            |.||.::.:...:.| .|.|.|.  |..|..::..|:  |..|.: |:||               
plant   634 HACSSKKALKAALAP-TPGKPHRVCDACYSKLKAAESGYSSNVNR-NVATPGRSIDGSVRTDRET 696

  Fly   533 -------LPAPK------------------------SLNTLRKVTFKSPQKFVTYGIENMPPPAV 566
                   |.|.|                        ||..|:.:.|.|...    .|:|...|.|
plant   697 TRSSKVLLSANKNSVMSSSRPGFTPESSNARASQVPSLQQLKDIAFPSSLS----AIQNAFKPVV 757

  Fly   567 KPAVNPPPTGVPMQMSVSSNDSGDSQASSTRRKSILSLFGLSRGSKATSKSLPSVNQVAQAAATR 631
            .|...||.|.|....|.|......|.:...||.|.....|.||   :...||...|:|.....|:
plant   758 APTTTPPRTLVIGPSSPSPPPPPRSSSPYARRPSPPRTSGFSR---SVIDSLRKTNEVMNQEMTK 819

  Fly   632 VQRPPLAVKPPITQEQPAEVPPVANLWTKEQK--KQAFELLAAMNAAEREAS 681
            :......:|.. ...|..|:       .:.||  |.|.||.|..::..:.|:
plant   820 LHSQVKNLKQR-CNNQGTEI-------ERFQKAAKDASELAARQSSKHKAAT 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857
S_TKc 19..281 CDD:214567
AT3G23270NP_001327882.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.