DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and NEK5

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_188722.2 Gene:NEK5 / 821634 AraportID:AT3G20860 Length:416 Species:Arabidopsis thaliana


Alignment Length:451 Identity:137/451 - (30%)
Similarity:221/451 - (49%) Gaps:53/451 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCD-ALVSEISVLRQLQHPNIV 79
            :.||||:..:|.|:||:.:.|..||....:..|.:...:..| :|. |.:.|:|::.:|:.|.||
plant     1 MDDYEVVEQIGRGAFGSAFLVIHKSERRKYVVKKIRLAKQTE-RCKLAAIQEMSLISKLKSPYIV 64

  Fly    80 QYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPN 144
            :|....|.::.  |.||...|.|||:.|:::::|......|:...|.|  ||..|:...|    |
plant    65 EYKDSWVEKDC--VCIVTSYCEGGDMTQMIKKSRGVFASEEKLCRWMV--QLLLAIDYLH----N 121

  Fly   145 GTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDV 209
            ..:||||:|.:||||......:|||||||::|.:| ..|:|.||||:||.|||:....|..|||:
plant   122 NRVLHRDLKCSNIFLTKENEVRLGDFGLAKLLGKD-DLASSMVGTPNYMCPELLADIPYGYKSDI 185

  Fly   210 WAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEV 274
            |::||.::|:.|.:|.|:......|..||.:...|.:|.:||:.|:.:|..||..:.|.||....
plant   186 WSLGCCMFEVAAHQPAFKAPDMAALINKINRSSLSPLPVMYSSSLKRLIKSMLRKNPEHRPTAAE 250

  Fly   275 IIRHPLVVRNISELDGKFPILVDSGEDFYTLPSGARLFEDEEEDGVHPELSSTMFTEQYSFNEGY 339
            ::|||.:...:::.....|:       |..:.|.:....:|...|:.|:..|.....:::.....
plant   251 LLRHPHLQPYLAQCQNLSPV-------FKPVVSKSEHNTNENRTGLPPKTKSAKTPIKHNQESEE 308

  Fly   340 GQRRLSVTGVFTPDLRSELFYSAKRKIFPAKKLQLSDPSLYESIRR--------EERAE--ERQV 394
            .:::       ..|..|    |:|.|..|||..::|..|....:|.        |||||  |..:
plant   309 TEKK-------NKDTSS----SSKDKERPAKSQEMSVISTLTLLREFQKKSPKSEERAEALESLL 362

  Fly   395 ELAEERRRKKDQEQQKRDQELLKEAPSSPRALTQNIFDEVLKTRLHAIRAQESLLQQKLEE 455
            ||.....|     |:|.| ||        ..:.:...||.:.:|..||...:||:..|.::
plant   363 ELCAGLLR-----QEKFD-EL--------EGVLKPFGDETVSSRETAIWLTKSLMNVKRKQ 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 97/263 (37%)
S_TKc 19..281 CDD:214567 96/262 (37%)
NEK5NP_188722.2 STKc_Nek 3..257 CDD:270855 97/263 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I1512
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 1 1.000 - - mtm947
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.