DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and AT3G02300

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001327030.1 Gene:AT3G02300 / 821167 AraportID:AT3G02300 Length:482 Species:Arabidopsis thaliana


Alignment Length:355 Identity:70/355 - (19%)
Similarity:106/355 - (29%) Gaps:135/355 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SFGTCYKVRDKSTGELFAWKGMNYDELDE----AKCDALVSEISVLRQLQHPNIVQYYHHLVNRE 89
            |.||.:.|.....|.|.||   .|:|..:    ..|:.          ||.|.::..|...::..
plant   183 SCGTAHVVALSEEGLLQAW---GYNEQGQLGRGVTCEG----------LQAPRVINAYAKFLDEA 234

  Fly    90 AKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKP 154
            .:.|.|:...|.....|.:....        |.|.|    .|....|:.|..:.:|   .:::.|
plant   235 PELVKIMQLSCGEYHTAALSDAG--------EVYTW----GLGSMGQLGHVSLQSG---DKELIP 284

  Fly   155 ANIF-------------------------LDAAGNAKLGDFGL-------------ARMLRRDQS 181
            ..:.                         |.|.|..:.|..||             :.||.|:  
plant   285 RRVVGLDGVSMKEVACGGVHTCALSLEGALYAWGGGQAGQLGLGPQSGFFFSVSNGSEMLLRN-- 347

  Fly   182 FAASFVGTPHYMSPELVKGRKYDRKSDVWAVGC-----LVY----EMCALRPPFRGRAFDQLS-- 235
                   .|..:.|           :||..|.|     |||    .:|.......|:|.::.|  
plant   348 -------VPVLVIP-----------TDVRLVACGHSHTLVYMREGRICGWGYNSYGQAANEKSSY 394

  Fly   236 --------------EKIAQGEFSRIPAIYSTDLQEIIAFMLA-----------VDHEQRPGIEVI 275
                          .|:|.|.........:..|:|:..|.||           .|...|.|.|.:
plant   395 AWYPSPVDWCVGQVRKLAAGGGHSAVLTDAFSLKELCEFQLADSVNLSNASEIQDVAFRMGSEAL 459

  Fly   276 IRHPLVVRNISE--LDGKFPILVDSGEDFY 303
            .|   :...:.|  |||.|    .:||:.|
plant   460 AR---LCERLREQLLDGDF----TNGEEVY 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 62/329 (19%)
S_TKc 19..281 CDD:214567 62/329 (19%)
AT3G02300NP_001327030.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.