DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and AT3G15430

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001325716.1 Gene:AT3G15430 / 820782 AraportID:AT3G15430 Length:488 Species:Arabidopsis thaliana


Alignment Length:292 Identity:56/292 - (19%)
Similarity:93/292 - (31%) Gaps:98/292 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 IFLDAAGNAKL------GDFGLARMLRRDQSFAASFVGTPHYMSP--ELVKGRKY----DRKSDV 209
            :||...|:|..      |..|....|.|.......|:.|   :.|  ::..|..|    .:...|
plant   229 VFLSREGHAYTCGSNTHGQLGHGDTLDRPVPKVVEFLKT---IGPVVQIAAGPSYVLAVTQDGSV 290

  Fly   210 WAVG-----CLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQR 269
            ::.|     ||.:          |...|:|..::.|                  ||       :|
plant   291 YSFGSGSNFCLGH----------GEQQDELQPRVIQ------------------AF-------KR 320

  Fly   270 PGIEVIIRHPLVVRNISELDGKFPILVDSGEDFYTLPSG--ARLFEDEEEDGVHPE----LSSTM 328
            .||.::        .:|..| :..:.:||....||...|  ..|...:|.|.:.|:    |::.:
plant   321 KGIHIL--------RVSAGD-EHAVALDSNGRVYTWGKGYCGALGHGDENDKITPQVLVNLNNCL 376

  Fly   329 FTE----------------QYSFN-EGYGQRRLSVTGVFTPDLRSELFYSAKRKIFPAKKLQLSD 376
            ..:                .|.|. .|:|.......||....||..:....|    |.:..|:| 
plant   377 AVQVCARKRKTFVLVEGGLLYGFGWMGFGSLGFPDRGVSDKVLRPRVLECLK----PHRVSQVS- 436

  Fly   377 PSLYESIRREER------AEERQVELAEERRR 402
            ..||.:|...:|      .:..:.:|..:..|
plant   437 TGLYHTIVVTQRGRIFGFGDNERAQLGHDSLR 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 26/140 (19%)
S_TKc 19..281 CDD:214567 26/140 (19%)
AT3G15430NP_001325716.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.