DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and HECTD3

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_078878.3 Gene:HECTD3 / 79654 HGNCID:26117 Length:861 Species:Homo sapiens


Alignment Length:523 Identity:105/523 - (20%)
Similarity:181/523 - (34%) Gaps:158/523 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LFAWKGMNYDELDEAKCD-ALVSEISVLRQLQ-HPNIVQYYHHLVNREAKSVYIVMECCAGG-DL 105
            ::..:|.|..:|.:...| .|:.::.||..:. |..|::..             ::||...| |:
Human   312 VYGGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIEIR-------------IVECRDDGIDV 363

  Fly   106 AQIVQRARSQRQR--------FEEPYIWR----------VLFQLCRALQ--------VCHNKIPN 144
            .....:.:|.|||        |:...:.|          ||::....||        |.|:.:|.
Human   364 RLRGVKIKSSRQRELGLNADLFQPTSLVRYPRLEGTDPEVLYRRAVLLQRFIKILDSVLHHLVPA 428

  Fly   145 -----GTILHRDIKPANIFLDAAGNAKLGDFGL-ARMLRRDQSFAASFVGTPHYMSPELVKGRKY 203
                 ||.  .:||....||..:....    || |:.||..:|...||:       |.|...|:.
Human   429 WDHTLGTF--SEIKQVKQFLLLSRQRP----GLVAQCLRDSESSKPSFM-------PRLYINRRL 480

  Fly   204 DRKSDVWAVGCLVYEMCALR-PPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQ-------EIIA- 259
                      .:.:..|..| |..:...|.|:.|.:...:....|..|...::       :.|| 
Human   481 ----------AMEHRACPSRDPACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAE 535

  Fly   260 -----------FMLAVDHEQRP-GIEVIIRHPLVVRNISELDGKFPILVDSGE--DFYTLPSGAR 310
                       .:..:..|..| ..:..:..|..||..::.:|       :||  |.|......|
Human   536 GIIDQGGGFRDSLADMSEELCPSSADTPVPLPFFVRTANQGNG-------TGEARDMYVPNPSCR 593

  Fly   311 LFEDEEEDG--------------------VHPELSSTMFTEQYSFNEGYGQRRLSVTGVFTPDLR 355
            .|...|..|                    |..:||.    |:.|:::.:.    :|..|....| 
Human   594 DFAKYEWIGQLMGAALRGKEFLVLALPGFVWKQLSG----EEVSWSKDFP----AVDSVLVKLL- 649

  Fly   356 SELFYSAKRKIFP---AKKLQ----LSDPSLYESI--------RREERAEERQVELAEERRRKKD 405
             |:.....::.|.   .|:|.    |||..:.|.|        ...:|:  |.::|.::.|.::.
Human   650 -EVMEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRS--RFIQLVQKARLEES 711

  Fly   406 QEQQKRDQE-LLKEAPSSPRALTQNIFDEVLKTRLH-AIRAQESLLQQKLEELQTREQELQLAEQ 468
            :||....|. |||..|       |.:.|.:....|. .:.....:....|.:| ||.::.:.::.
Human   712 KEQVAAMQAGLLKVVP-------QAVLDLLTWQELEKKVCGDPEVTVDALRKL-TRFEDFEPSDS 768

  Fly   469 RVQ 471
            |||
Human   769 RVQ 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 56/292 (19%)
S_TKc 19..281 CDD:214567 56/292 (19%)
HECTD3NP_078878.3 APC10-HECTD3 238..371 CDD:176487 13/71 (18%)
HECT 579..845 CDD:366212 46/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.