DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and rcbtb2

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_005173422.1 Gene:rcbtb2 / 794652 ZFINID:ZDB-GENE-071016-3 Length:527 Species:Danio rerio


Alignment Length:68 Identity:18/68 - (26%)
Similarity:31/68 - (45%) Gaps:10/68 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GMDFSQKTLQDYEVLAVMGNG----SFGT-CYKVRDKSTGELFAWKGMNYDELDEAKCD-----A 62
            |:..:|.|::...:..:.|..    |:|| .:.|...:.||::||....|.:|.....:     |
Zfish    55 GLGDTQSTIEPRRIDILCGKKIISLSYGTGPHVVIATADGEVYAWGHNGYSQLGNGTTNHGLTPA 119

  Fly    63 LVS 65
            |||
Zfish   120 LVS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 15/58 (26%)
S_TKc 19..281 CDD:214567 15/57 (26%)
rcbtb2XP_005173422.1 RCC1 40..89 CDD:278826 7/33 (21%)
RCC1 93..143 CDD:278826 10/30 (33%)
RCC1 146..196 CDD:278826
RCC1 199..248 CDD:278826
RCC1 251..299 CDD:278826
BTB 364..460 CDD:279045
BTB 371..463 CDD:197585
SPOP_C_like 463..521 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.