powered by:
Protein Alignment Nek2 and rcbtb2
DIOPT Version :9
Sequence 1: | NP_572415.1 |
Gene: | Nek2 / 31696 |
FlyBaseID: | FBgn0029970 |
Length: | 735 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005173422.1 |
Gene: | rcbtb2 / 794652 |
ZFINID: | ZDB-GENE-071016-3 |
Length: | 527 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 18/68 - (26%) |
Similarity: | 31/68 - (45%) |
Gaps: | 10/68 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GMDFSQKTLQDYEVLAVMGNG----SFGT-CYKVRDKSTGELFAWKGMNYDELDEAKCD-----A 62
|:..:|.|::...:..:.|.. |:|| .:.|...:.||::||....|.:|.....: |
Zfish 55 GLGDTQSTIEPRRIDILCGKKIISLSYGTGPHVVIATADGEVYAWGHNGYSQLGNGTTNHGLTPA 119
Fly 63 LVS 65
|||
Zfish 120 LVS 122
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1062377at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.