DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and herc5.2

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_005160175.1 Gene:herc5.2 / 794323 ZFINID:ZDB-GENE-090311-16 Length:987 Species:Danio rerio


Alignment Length:472 Identity:84/472 - (17%)
Similarity:158/472 - (33%) Gaps:164/472 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSE-ISVLRQLQHPNIVQYYHHLV 86
            ||..||||     ::.....:.|...|.::.:|.:.  :.::|| :.|::|...|::.....|  
Zfish   399 AVCLNGSF-----LKPSLDEQDFDLVGKSFSKLTDN--EKVISEVVKVIQQTLLPSLNPKPAH-- 454

  Fly    87 NREAKSVYIVMECCAGGDLAQIVQRARS-QRQRFEEPYIWRVLFQLCRA----LQVCHNKIPNG- 145
             .|:..:|::        |.::::.... ||....:....::| ||..|    |::..:|:|:. 
Zfish   455 -EESLRLYLL--------LPELIKGLEQYQRSELNKALASKIL-QLNSAAREMLEMFWSKLPDDW 509

  Fly   146 -----TILHRDIKPANIFLDAAGNAKLGDF--------------GLARMLRRDQSFAASFVGTPH 191
                 .:.|::            :|.|.|:              .|.|:|:.......|      
Zfish   510 LKSLVKLFHKE------------SADLIDYMSVCAMDSDLKHLQNLLRILQMAYKVCCS------ 556

  Fly   192 YMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSE---KIAQGEFSRIPAIYSTD 253
                         ...|:.....::||:..|....:. ..|.|::   .:......::...:...
Zfish   557 -------------THRDITISDFIIYEISDLLNALQA-TIDDLADWDPFVDYVYMMKLRDYFIKT 607

  Fly   254 LQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNISELDGKF--------------PILVDS------ 298
            |:.::.|....|:..:.|   |..| |.::.|.....:|              .:|:|:      
Zfish   608 LEILVKFPFVADYASKRG---IFNH-LEIKMIRRSSNRFLGNATFNVLHINRESLLMDTLKYLRQ 668

  Fly   299 --------------GED----------FYTLPSGARLFEDEEEDGVHPELSSTMFTEQYSFNEGY 339
                          |||          |::|.|.:.|..|::...|||  ||.::     ||..:
Zfish   669 NTHSFSHLSRVAFIGEDGIDMRGLSAEFFSLISKSFLKWDKKILEVHP--SSLVW-----FNPHH 726

  Fly   340 --GQRRLSVTGV-----------FTPDLRSELFYSAKRKIFPAKKLQLSDPSLYESIRREERAEE 391
              |.:.....||           ...|....||          |||....|||      ::..|.
Zfish   727 TRGNKNFYYLGVICGMALYNRHHINIDFPLALF----------KKLLQQKPSL------DDLEEL 775

  Fly   392 RQVELAEERRRKKDQEQ 408
            ..||....:...|:.|:
Zfish   776 SPVEARSLKNLLKEDEE 792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 47/286 (16%)
S_TKc 19..281 CDD:214567 47/286 (16%)
herc5.2XP_005160175.1 RCC1_2 120..149 CDD:290274
RCC1 136..186 CDD:278826
RCC1 189..238 CDD:278826
RCC1 242..290 CDD:278826
RCC1 296..347 CDD:278826
HECTc 649..985 CDD:294058 34/167 (20%)
HECTc 678..984 CDD:214523 32/138 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.