DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Herc4

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_084390.1 Gene:Herc4 / 67345 MGIID:1914595 Length:1057 Species:Mus musculus


Alignment Length:433 Identity:86/433 - (19%)
Similarity:130/433 - (30%) Gaps:160/433 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GEESAGMDFSQKTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYD-EL---DEAKCDAL 63
            |.|.:.....|....|.:.:..:..|...| ..:.||  |:::|| |::.| :|   ...:|..:
Mouse    67 GHEKSRKKPEQVVALDAQNIVAVACGEAHT-LALNDK--GQVYAW-GLDSDGQLGLQGSEECIRV 127

  Fly    64 VSEISVLRQLQHPNIVQ----YYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYI 124
            ...|..|..:|   |||    |||.|...:|..|:    |.......|:......|:|  ..|.:
Mouse   128 PRNIKSLSDIQ---IVQVACGYYHSLALSKASEVF----CWGQNKYGQLGLGIDCQKQ--TSPQL 183

  Fly   125 WRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGT 189
            .:.|      |.:...::..|. .|..:...:..:...|..|.|..||     .|::        
Mouse   184 IKSL------LGIPFMQVAAGG-AHSFVLTLSGAIFGWGRNKFGQLGL-----NDEN-------- 228

  Fly   190 PHYMSPELVKGRKYDRKSDVWAVGCLVYEMC------ALRP-----PFRGRAFDQLSEKIAQGEF 243
            ..|: |.|:|..:..:         :||..|      ||..     .|....:.||...      
Mouse   229 DRYV-PNLLKSLRSQK---------IVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHN------ 277

  Fly   244 SRIPAIYSTDLQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNISELDGKFPILVDSGEDFYT--LP 306
                               :..||..|            |.:.||.|.....|..|....:  :|
Mouse   278 -------------------STSHEINP------------RKVFELMGSIVTQVACGRQHTSAFVP 311

  Fly   307 SGARLFEDEEEDGVHPELSSTMFTEQYSFNEGYGQRRL-------------------SVTGVFTP 352
            |..|:                     |||..| |..:|                   |..|....
Mouse   312 SSGRI---------------------YSFGLG-GNGQLGTGSTSNRKSPFTVKGNWFSYNGQCPQ 354

  Fly   353 DLRSELFYSAKRKIF-----------------PAKKLQLSDPS 378
            |:.||.::..|| ||                 |....:.||||
Mouse   355 DIGSEDYFCVKR-IFSGGDQSFSHYSSPQNCGPPDDFRCSDPS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 54/281 (19%)
S_TKc 19..281 CDD:214567 53/280 (19%)
Herc4NP_084390.1 RCC1 1 1..51
RCC1 3..49 CDD:278826
RCC1 2 52..101 6/34 (18%)
RCC1 52..99 CDD:278826 6/32 (19%)
RCC1 3 102..154 18/57 (32%)
RCC1 102..152 CDD:278826 18/55 (33%)
RCC1 4 156..207 10/63 (16%)
RCC1 157..205 CDD:278826 10/60 (17%)
RCC1 5 208..259 15/73 (21%)
RCC1 208..257 CDD:278826 13/71 (18%)
RCC1 260..308 CDD:278826 12/84 (14%)
RCC1 6 261..311 12/86 (14%)
RCC1 7 313..366 12/74 (16%)
RCC1 313..>343 CDD:278826 7/51 (14%)
HECTc 709..1055 CDD:238033
HECTc 735..1054 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.