DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and RPGR

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001030025.1 Gene:RPGR / 6103 HGNCID:10295 Length:1152 Species:Homo sapiens


Alignment Length:360 Identity:69/360 - (19%)
Similarity:132/360 - (36%) Gaps:82/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 NGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSD 208
            |.|.|..||.....|    |:.:.|..||..     ::|...|:  |...|..|        :..
Human   305 NHTALITDIGLMYTF----GDGRHGKLGLGL-----ENFTNHFI--PTLCSNFL--------RFI 350

  Fly   209 VWAVGCLVYEMCALRPPFRGRA----FDQLSEK-IAQGEFSRIPAIYSTDL--QEIIAFMLAVDH 266
            |..|.|....|.....|.||.|    ||::::. ::...|....::.|.::  :.:.|.|...:.
Human   351 VKLVACGGCHMVVFAAPHRGVAKEIEFDEINDTCLSVATFLPYSSLTSGNVLQRTLSARMRRRER 415

  Fly   267 EQRP----------------GIEVIIRHPLVVRNISELDGKFPILVDSGEDFYTLPSGARLFEDE 315
            |:.|                |:........|....||.:.:..:|  |.:|         |.:.|
Human   416 ERSPDSFSMRRTLPPIEGTLGLSACFLPNSVFPRCSERNLQESVL--SEQD---------LMQPE 469

  Fly   316 EEDGVHPELSSTMFTEQYSFNEGYGQRR--LSVTGVFTPDLRSELFYSAKRKIFPAKKLQLSDPS 378
            |.|.:..|::.....:..|..|..|:..  |::|.:.:                    |..::.|
Human   470 EPDYLLDEMTKEAEIDNSSTVESLGETTDILNMTHIMS--------------------LNSNEKS 514

  Fly   379 LYESIRREERAEERQVELAEERR-RKKDQEQQKRDQELLKEAPSSPRALTQNIFDEVLKTRLHAI 442
            |..|..::::.::...||.::.. .:.|...:..:...:||..:..:.::|.||.....|.:.|.
Human   515 LKLSPVQKQKKQQTIGELTQDTALTENDDSDEYEEMSEMKEGKACKQHVSQGIFMTQPATTIEAF 579

  Fly   443 RAQESLLQQKLEELQ------TREQELQLAEQRVQ 471
            ..:|..:.::.|..:      ..|||::..|:.|:
Human   580 SDEEVEIPEEKEGAEDSKGNGIEEQEVEANEENVK 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 32/159 (20%)
S_TKc 19..281 CDD:214567 32/159 (20%)
RPGRNP_001030025.1 RCC1 <38..312 CDD:332518 3/6 (50%)
RCC1 314..360 CDD:306840 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.