DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and Nek7

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_067618.1 Gene:Nek7 / 59125 MGIID:1890645 Length:302 Species:Mus musculus


Alignment Length:292 Identity:102/292 - (34%)
Similarity:159/292 - (54%) Gaps:26/292 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EESAGM----------------DFSQKTLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNY 52
            |:|.||                |....||.::.:...:|.|.|...|:......|...|.|.:..
Mouse     3 EQSQGMQGPPVTQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQI 67

  Fly    53 DELDEAKCDA-LVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQR 116
            .:|.:||..| .:.||.:|:||.|||:::||...:  |...:.||:|....|||:::::..:.|:
Mouse    68 FDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFI--EDNELNIVLELADAGDLSRMIKHFKKQK 130

  Fly   117 QRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQS 181
            :...|..:|:...|||.||...|::    .::||||||||:|:.|.|..||||.||.|......:
Mouse   131 RLIPERTVWKYFVQLCSALDHMHSR----RVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTT 191

  Fly   182 FAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFD--QLSEKIAQGEFS 244
            .|.|.||||:|||||.:....|:.|||:|::|||:|||.||:.||.|...:  .|.:||.|.::.
Mouse   192 AAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYP 256

  Fly   245 RIPA-IYSTDLQEIIAFMLAVDHEQRPGIEVI 275
            .:|: .||.:|::::...:..|.|:||.|..:
Mouse   257 PLPSDHYSEELRQLVNICINPDPEKRPDIAYV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 95/262 (36%)
S_TKc 19..281 CDD:214567 95/261 (36%)
Nek7NP_067618.1 NTE motif. /evidence=ECO:0000250 20..33 3/12 (25%)
STKc_Nek6_7 33..294 CDD:270863 95/262 (36%)
S_TKc 34..286 CDD:214567 94/257 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.