DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and hectd3

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001070627.2 Gene:hectd3 / 563189 ZFINID:ZDB-GENE-031118-179 Length:854 Species:Danio rerio


Alignment Length:235 Identity:54/235 - (22%)
Similarity:86/235 - (36%) Gaps:55/235 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 DGVHPELSSTM-FTEQYSFNEGYGQRRLSVTGVFTPDLRSELFYSAKRKIFPAKKLQLSDPSLYE 381
            |.|..:|...| ..::.:|:..:||               ||.|:.          .|||..|.|
Zfish   635 DSVLVKLLEAMDHMDKETFDFKFGQ---------------ELVYTT----------PLSDGRLVE 674

  Fly   382 SI--------RREERAEERQVELAEERRRKKDQEQQKRDQE-LLKEAPSSPRALTQNIFDEVLKT 437
            .|        |.|:|.|  .:.|.::.|.::::||....|. |:|..|.:  .|....:.||.| 
Zfish   675 LIPGGSGVVVRYEDRVE--FIRLVQKARLEENREQISAMQAGLVKVVPQA--VLDLLTWQEVEK- 734

  Fly   438 RLHAIRAQESLLQQKLEELQTREQELQLAEQRVQTLERQMQEKLLQQEKH-----TCSCRQPIAP 497
               .:.....:..:.|:.| ||.::|:..:.|||.|...:.....:....     |...|.|...
Zfish   735 ---KVCGDPEITVEALKRL-TRYEDLEQTDVRVQYLWEALMNFTNEDRSRFLRFVTGRSRLPAPI 795

  Fly   498 PIPPRKPAKSHHDDTYCTIELNETSPTVAKLNLATLPAPK 537
            .|.|.|......|      .|.::|...:.|.|...|:.|
Zfish   796 YIFPDKQGSETED------ALPQSSTCSSTLYLPKYPSAK 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857
S_TKc 19..281 CDD:214567
hectd3NP_001070627.2 APC10-HECTD3 231..366 CDD:176487
HECTc 523..842 CDD:214523 54/235 (23%)
HECT 561..838 CDD:279026 54/235 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.