DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and herc5.1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_017211386.1 Gene:herc5.1 / 559981 ZFINID:ZDB-GENE-090311-56 Length:884 Species:Danio rerio


Alignment Length:132 Identity:27/132 - (20%)
Similarity:45/132 - (34%) Gaps:60/132 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 VQTLERQMQEKLLQQEKHTCSCRQPIAPPIPPRKP------------------AKSHHD------ 510
            :.|.:..|.|:        |.|.:      .|||.                  .|:.||      
Zfish   256 IMTFDNGMIEQ--------CECGK------DPRKAIKDLKKVFSSAASLNGSFLKTRHDGHYQTS 306

  Fly   511 DTYCTIELNETSPTVAKLNLATLPAPKSL-NTLRKVTFKSPQKFVTYGIENMPPPAVKPAVNPPP 574
            :.||.::..     :.:.::|||...:.| :|:.||..:|                :.|.:||.|
Zfish   307 EEYCGLDFG-----LVESSIATLSRNERLISTVLKVLQES----------------LLPTLNPNP 350

  Fly   575 TG 576
            ||
Zfish   351 TG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857
S_TKc 19..281 CDD:214567
herc5.1XP_017211386.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.