DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and si:ch211-285c6.3

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_017212428.1 Gene:si:ch211-285c6.3 / 557131 ZFINID:ZDB-GENE-040724-148 Length:543 Species:Danio rerio


Alignment Length:233 Identity:74/233 - (31%)
Similarity:127/233 - (54%) Gaps:28/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYI--WRVL 128
            :::.|..|.||:||  :|..:.|:...:|:|::.|.|||||:.:::|..|   |.|..|  |.| 
Zfish    45 DVNFLLHLDHPHIV--HHKEIIRDGDDLYLVLDHCEGGDLAEKIKQATGQ---FSEKEILDWTV- 103

  Fly   129 FQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPH-- 191
             |:|.||:..|::    .|||:|::|.::...|.|..:||:|        |:.|  :.|.|..  
Zfish   104 -QICMALKHLHDQ----QILHKDLQPKSLLFTACGTIRLGEF--------DKWF--TDVQTAETE 153

  Fly   192 ---YMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTD 253
               |.:||.:....|..||::|.:||::.|||.|:..|.....|::.:||.:..:..:|..:|.|
Zfish   154 SLAYFAPENLHDTSYYEKSEIWRLGCIICEMCTLKKAFSSGNTDEIIKKICRSSYEHLPTNFSED 218

  Fly   254 LQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNISELDGK 291
            |||:|...|.|:...||.:..|:..|.:::::.|:..|
Zfish   219 LQELIKDTLQVNPADRPSVSEILMRPFIIKHLREMSKK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 72/221 (33%)
S_TKc 19..281 CDD:214567 72/221 (33%)
si:ch211-285c6.3XP_017212428.1 PKc_like 23..246 CDD:304357 72/221 (33%)
S_TKc 25..246 CDD:214567 72/221 (33%)
ApoL 260..>347 CDD:283187
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.