DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and rcc1l

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001076272.1 Gene:rcc1l / 555972 ZFINID:ZDB-GENE-060526-370 Length:451 Species:Danio rerio


Alignment Length:161 Identity:33/161 - (20%)
Similarity:60/161 - (37%) Gaps:44/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 VGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYS 251
            :|.|.::.|:  .|||..||:.:... ||..|              |.....|.|....:.|..:
Zfish    65 LGIPSFVVPD--SGRKKPRKTQLTPY-CLDTE--------------QKISSAACGYGFTLLASNT 112

  Fly   252 TDLQEIIAFMLAVD---------HEQRPGIEVIIR-HPLVVRNISELDGKFP----------ILV 296
            .||.::....|..|         |::....:.::. .|:.:..::..:.:.|          :|.
Zfish   113 KDLTKLWGMGLNKDSQLGFQRTQHDKSKSYDYVLEASPVSLPLLNPQETRVPQVSCGRAHSLVLT 177

  Fly   297 DSGEDFYTLPS------GARLFEDEEEDGVH 321
            || |..:::.|      |.::.|||...|.|
Zfish   178 DS-EGVFSMGSNTFGQCGRKIVEDEVYSGSH 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 21/103 (20%)
S_TKc 19..281 CDD:214567 21/103 (20%)
rcc1lNP_001076272.1 RCC1 52..108 CDD:278826 14/59 (24%)
RCC1_2 165..192 CDD:290274 5/27 (19%)
RCC1 182..232 CDD:278826 7/26 (27%)
RCC1_2 219..248 CDD:290274
RCC1 236..285 CDD:278826
RCC1 288..338 CDD:278826
RCC1_2 383..412 CDD:290274
RCC1 400..446 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.