DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and RCBTB1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001339429.1 Gene:RCBTB1 / 55213 HGNCID:18243 Length:531 Species:Homo sapiens


Alignment Length:62 Identity:14/62 - (22%)
Similarity:26/62 - (41%) Gaps:4/62 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKS----VYIVMEC 99
            |.|:||....|.:|.....:.|:|...::.:.:....:...|......||:    ||:..:|
Human   252 GLLYAWGANTYGQLGTGNKNNLLSPAHIMVEKERVVEIAACHSAHTSAAKTQGGHVYMWGQC 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 14/62 (23%)
S_TKc 19..281 CDD:214567 14/62 (23%)
RCBTB1NP_001339429.1 RCC1 1 40..91
ATS1 43..>316 CDD:227511 14/62 (23%)
RCC1 2 93..145
RCC1 3 147..198
RCC1 4 199..250
RCC1 5 252..302 10/49 (20%)
RCC1 6 304..356 3/10 (30%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662
BACK_RCBTB1 466..531 CDD:350603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.