powered by:
Protein Alignment Nek2 and rcbtb1
DIOPT Version :9
Sequence 1: | NP_572415.1 |
Gene: | Nek2 / 31696 |
FlyBaseID: | FBgn0029970 |
Length: | 735 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017352.2 |
Gene: | rcbtb1 / 550106 |
XenbaseID: | XB-GENE-987316 |
Length: | 599 |
Species: | Xenopus tropicalis |
Alignment Length: | 46 |
Identity: | 11/46 - (23%) |
Similarity: | 20/46 - (43%) |
Gaps: | 3/46 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 GELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQY---YHH 84
||:::|....|.:|........|:.:.|..:|....::|. .||
Frog 163 GEVYSWGHNGYSQLGNGNAIQGVAPVQVCMELLAKKVIQVACGSHH 208
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1062377at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.