DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and rcbtb1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001017352.2 Gene:rcbtb1 / 550106 XenbaseID:XB-GENE-987316 Length:599 Species:Xenopus tropicalis


Alignment Length:46 Identity:11/46 - (23%)
Similarity:20/46 - (43%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQY---YHH 84
            ||:::|....|.:|........|:.:.|..:|....::|.   .||
 Frog   163 GEVYSWGHNGYSQLGNGNAIQGVAPVQVCMELLAKKVIQVACGSHH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 11/46 (24%)
S_TKc 19..281 CDD:214567 11/46 (24%)
rcbtb1NP_001017352.2 RCC1 111..153 CDD:278826
RCC1 162..212 CDD:278826 11/46 (24%)
RCC1 215..265 CDD:278826
RCC1 268..317 CDD:278826
RCC1_2 304..333 CDD:290274
RCC1 321..362 CDD:278826
BTB 428..532 CDD:279045
BTB 439..535 CDD:197585
SPOP_C_like 535..591 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.