DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and rcc1

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001016101.1 Gene:rcc1 / 548855 XenbaseID:XB-GENE-979094 Length:420 Species:Xenopus tropicalis


Alignment Length:42 Identity:14/42 - (33%)
Similarity:22/42 - (52%) Gaps:4/42 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGEES---AGMDFSQKTLQDYEVLAVMGNGSFGTCYKVRDKS 40
            :|||.   :..:.:.|.|:|.:||:|...|.. |...||.:|
 Frog   380 TGEEEDVWSPQEMTGKQLEDRDVLSVSSGGQH-TVLLVRKRS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 9/23 (39%)
S_TKc 19..281 CDD:214567 8/22 (36%)
rcc1NP_001016101.1 ATS1 21..418 CDD:227511 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.