DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nek2 and rcc1l

DIOPT Version :9

Sequence 1:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001007510.1 Gene:rcc1l / 493236 XenbaseID:XB-GENE-963910 Length:449 Species:Xenopus tropicalis


Alignment Length:125 Identity:30/125 - (24%)
Similarity:44/125 - (35%) Gaps:52/125 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQH--PNI 78
            |.|.|.:..:||.|:|.|  .|:...||::                   ||..::.:::.  ..:
 Frog   174 LTDKEGVFSLGNNSYGQC--AREVIEGEIY-------------------SESQLIHRVRELDSRV 217

  Fly    79 VQYY----HHLVNREAKSVYIVMEC---------------CA-----GGDLA--QIVQRA 112
            ||..    |.|...|...||   .|               |:     |||:|  .|||.|
 Frog   218 VQVACGQDHSLFRTEKGEVY---SCGWGADGQTGLGHFNVCSNPTKLGGDMAGVNIVQVA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 29/123 (24%)
S_TKc 19..281 CDD:214567 28/122 (23%)
rcc1lNP_001007510.1 RCC1 <51..374 CDD:332518 30/125 (24%)
RCC1_2 381..410 CDD:316098
RCC1 398..444 CDD:306840
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.